KEGG   Lactobacillus reuteri SD2112: HMPREF0538_20018
Entry
HMPREF0538_20018  CDS       T01551                                 

Name
(GenBank) putative levansucrase
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
lru00500  Starch and sucrose metabolism
lru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0538_20018
Enzymes [BR:lru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     HMPREF0538_20018
SSDB
Motif
Pfam: Glyco_hydro_68 Gram_pos_anchor
Other DBs
NCBI-ProteinID: AEI56232
UniProt: F8DRC0
Position
complement(14882..16657)
AA seq 591 aa
MNFSKAAKSGTQMTYNDLKKIGEALVDQDPKYAIPYFNASQIKNMPAAYTRDAETGEYAD
LDIWDSWPVQDPVTGYVSNWNGYQLVIAMMGRPHHEDNHIYLLYNKYGDNDFSHWRNAGS
IFGYNESPLTQEWSGSAIVNSDNSIQLFYTINDTNNAINHQKLASATMYLTADNDGVHIN
NVENNHVVFAGDGYHYQTYDQWKAANSFADNYTLRDGHVVQMPNGDRYLVFEGNTGTENY
QGEDQLYNWSNYGGNDRFNIESLFHLLSSDVDYKKAIFANGALGIIKLTNDEKNPQVEEV
YTPLVTSNMVSDELERPNVVKLGDKYYLFSATRLSRGTNIDTLNKANKVVGDNVAMIGYV
ADSLTGPYKPLNGSGVVVTASVPANWRTATYSYYAVPVEGKENQLLITSYMTNRGEVAGK
GMNSTWAPSFIVQINPDDTTMVLAKVTNQGDWIWDESSNNNNMLGNIQTAALPGEFGKPI
DWDLIGGYGLKPHDPATPNDPETPTTPETPETPNTPETPKTPENPGTPQTPDTPNTPEVP
LTPETPKQPETQTNNRLPQTGNNANKAMIGLGMGTLLSMFGLAGINKRRVN
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgaacttctcgaaagctgcaaagtctggtacacaaatgacttataatgaccttaaaaag
attggtgaggctttagttgatcaagatcctaaatacgctattccttattttaatgcaagt
caaataaagaatatgcccgctgcatatactagggatgctgaaacaggtgaatatgctgat
ttagatatttgggattcatggccagttcaagatccagtgactggttatgtttctaattgg
aatggctatcaacttgtgatcgctatgatgggacggcctcatcacgaagataatcatatt
tatttactttataataagtatggtgataatgatttttcacactggcgaaatgcaggatct
atatttggatataatgaatctccactaacacaagaatggtccgggtctgctattgttaat
tctgacaactctattcaactcttttatactatcaatgatacaaataatgctattaaccat
caaaaattagcaagtgctactatgtacttaacagccgacaatgatggtgtccatattaat
aatgtagagaataatcatgtggtatttgcaggtgatggttatcattaccaaacttatgat
caatggaaagctgcaaatagttttgctgacaactacactttgcgggatggacatgttgta
caaatgccaaatggtgatcggtatttagtatttgaaggaaatactggaactgaaaattat
caaggtgaagatcaattatataattggtcaaattatggtggtaacgatcgctttaatatt
gaaagcttgtttcatcttttaagtagtgatgttgattataaaaaagctatctttgctaac
ggggcacttggaattattaaactaacgaatgatgaaaagaacccgcaagtagaagaagta
tatactccattagttacatcaaatatggttagtgatgaacttgaacgtcctaatgttgtt
aaacttggagataagtattatctattctcggctacacgtttaagcagaggaactaatatc
gatactcttaataaagctaataaagttgtcggagataatgttgcaatgattggttacgta
gccgatagtcttacaggtccatataaaccattaaatggttcaggggttgtagtgacagct
tctgttcctgccaattggcgtaccgctacttattcttactatgctgttccagtagaagga
aaagaaaatcaattactcattacttcgtatatgacaaatagaggcgaagttgctggaaaa
ggtatgaattcaacatgggcaccaagttttattgtgcaaattaatcctgatgatacaact
atggtattagctaaagtaactaaccaaggggattggatttgggacgaatcaagtaacaat
aataatatgttaggaaacattcaaacagctgctttacctggggaatttggtaaaccaatt
gattgggatttaattggtggttatggattaaaaccgcatgatcctgctacaccaaatgat
cctgaaacgccaactacaccagaaacccctgagacacctaatactcccgaaacaccaaag
actcctgaaaatcctgggacacctcaaactcccgatacacctaatactccggaagttcct
ttaactccagaaacgcctaagcaacctgaaacccaaactaataatcgtttaccacaaact
ggaaataacgccaataaagccatgattggcctaggtatgggaacattgcttagtatgttt
ggtcttgcaggaattaacaaacgtcgagttaactaa

DBGET integrated database retrieval system