KEGG   Leifsonia shinshuensis: F1C12_16080
Entry
F1C12_16080       CDS       T06806                                 

Name
(GenBank) glycoside hydrolase family 15
  KO
K22308  isomaltose glucohydrolase [EC:3.2.1.205]
Organism
lse  Leifsonia shinshuensis
Brite
KEGG Orthology (KO) [BR:lse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F1C12_16080
Enzymes [BR:lse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.205  isomaltose glucohydrolase
     F1C12_16080
SSDB
Motif
Pfam: Glyco_hydro_15 TPR_7 TPR_14
Other DBs
NCBI-ProteinID: QNE36480
UniProt: A0A7G6YDB5
Position
3313204..3314370
AA seq 388 aa
MPRYTSSPLAERSRALIASLQTAEGAYPASPTFSAYTGYSWFRDGAFIADGMSATGEAES
AERFFDWCAAVLTDRADHIHWIVAETRAGRPPAGAQMLPARYTFAGGAGDDEWWDFQLDG
YGTWLWAVVEHSRRHNVDAGRWSQAIGLTTDYLVASWDRPCYDWWEEHSEHVHVSTLACV
AAGLDAVTDAGLLDGAREAGARDASAAIRRLVQERGTLSGHLVKWLGSTAVDGSLAAALA
PLGFADPRSATGAATIDLLERHLTVNGGTHRYLGDTFFGGGQWPLLSCFLGLAQLAAGDR
ARAVELYEWAASTATEDLDLPEQVSAHLIAPGMRWEWVDRWGTVATPLLWSHAMLLRLGA
ELDATAPDSAADTSAAPATDSVLEGLAR
NT seq 1167 nt   +upstreamnt  +downstreamnt
gtgcctcgttacacctcctccccgctcgccgagcgcagccgtgccctgatcgccagcctg
cagaccgccgagggcgcgtaccccgccagcccgacgttctcggcctacaccggttacagc
tggttccgcgacggtgcgttcatcgcggacggcatgtcggcgacgggggaggcggagagc
gcagagcgcttcttcgactggtgcgccgctgtgctcaccgaccgcgccgaccacatccac
tggatcgtcgcggagacgcgggccggccggcctccggccggggcgcagatgcttcccgcc
cgctacacgttcgccgggggcgccggagacgacgagtggtgggacttccagctcgacggc
tacggcacgtggctctgggccgtggtcgagcactcccgccgccacaacgtcgacgctggt
cgctggtcgcaggcgatcgggctgacgaccgactacctcgtggcctcctgggatcggccc
tgctacgactggtgggaggagcacagcgagcacgtgcacgtctccacgctcgcgtgcgtg
gcggccgggctggacgccgtgaccgatgccggcctcctcgacggtgcgcgagaggccgga
gcacgcgacgcgtcggccgcgatccgccggctcgtgcaggagcgcgggacactctccggt
catctcgtgaagtggctcggcagcaccgcggtcgacgggagtctcgcggccgcgctcgcc
ccgctcgggttcgccgacccccgctccgccaccggcgcggcgaccatcgatctgctggag
cgccacctgacggtcaacggggggacgcaccgctacctcggcgacaccttcttcggcggc
ggccagtggccgctgctcagctgcttcctcgggctggcccagctcgccgcgggtgatcgc
gcgcgagcggtcgagctgtacgagtgggcggcctccaccgccaccgaggacctcgacctc
cccgagcaggtcagcgctcacctgatcgcccccgggatgcgctgggaatgggtggaccgc
tgggggaccgtggcgactccgctgctgtggagccacgccatgctgctgcggctcggcgcg
gaactcgacgccaccgcgcccgacagcgcggccgacacctctgccgcccccgccaccgac
tccgtcctggaaggactcgcacgatga

DBGET integrated database retrieval system