KEGG   Lactobacillus sanfranciscensis: LSA_02160
Entry
LSA_02160         CDS       T01627                                 

Symbol
ftf
Name
(GenBank) Levansucrase
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
lsn00500  Starch and sucrose metabolism
lsn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LSA_02160 (ftf)
Enzymes [BR:lsn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     LSA_02160 (ftf)
SSDB
Motif
Pfam: Glyco_hydro_68 KxYKxGKxW_sig Gram_pos_anchor
Other DBs
NCBI-ProteinID: AEN98680
UniProt: G2KV82
Position
215831..218329
AA seq 832 aa
MTKEHKKMYKAGKYWAVATLVSASILMEVGVTTHADAVENNKYDGTANVNIDCQANVDGK
IISTDDNATSGSTKQESSIANDNATSGSTKQESSIANDNATSGSTKQESSIANDNATSGS
TKQESSVANDNATSGSTKQESSVANDNATSGSTKQESSVANDNATSGSTKQESSVANDTK
TAVVDESKNTSNTENDNSQLKQTNNEQPSAATQANLKKLNHEAAKAVQNAKIDAGSLTDE
QINELNKINFSKSAEKGAKLTFKDLEGIGNAIVKQDPQYAVPYFNAKEIKNMPASYTVDA
QTGKMAHLDVWDSWPVQDPVTGYVSNYKGYQLVIAMMGIPNTPNGDNHIYLLYNKYGDND
FSHWRNAGSIFGTNENNVYQEWSGSAIVNDNGTIQLFYTSNDTSDYKLNDQRLATATLNL
DVDDNGVAIKSVDNYHILFEGDGFHYQTYDQFANGKDRKNDDYCLRDPHVVQSENGDRYL
VFEANTGMEDYQSDDQIYNWANYGGDDAFNIKSFFKLLNNKNDRELASLANGAIGILKLN
NDQTNPKVEEVYSPLVSTLMASDEVERVNVVKLGDKYYLFSATRVSRGSDRELNAKDITI
VGDNVAMIGYVSDNLMGKYKPLNNSGVVLTASVPANWRTATYSYYAVPVEGHPDQVLITS
YMSNKDFASGEGNYATLAPSFIVQINPDDTTTVLARATNQGDWVWDDSSRNDNMLGVLKE
GAVNSAALPGEWGKPVDWSLINRSSGLGLKPHQPVNPSQPTTPATPVNPSQPTTPAKPVQ
AGQATATNFVDQRLPQTGENNSQSQTMSFIGILLAMFGSLLGFLGIKKRRND
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgactaaagaacataagaaaatgtataaagccggtaagtactgggccgttgctacacta
gtatcagcttcaattttaatggaggtgggagtaaccacccacgctgatgctgttgagaac
aataaatacgatggcactgctaacgttaacattgattgccaagctaatgttgatgggaag
attatcagtactgatgataatgcaaccagtggctcgacaaagcaagaatcatctattgct
aatgataatgcaaccagtggctcgacaaagcaagaatcatctattgctaatgataatgca
accagtggctcgacaaagcaagaatcatctattgctaatgataatgcaaccagtggctcg
acaaagcaagaatcatctgttgctaacgataatgcaaccagtggttcgacaaagcaagaa
tcatctgttgctaacgataatgcaaccagtggttcgacaaagcaagaatcatctgttgct
aacgataatgcaaccagtggttcgacaaagcaagaatcatctgttgctaatgatactaaa
actgctgttgttgacgaaagtaaaaatactagcaacacagaaaatgataatagtcaatta
aagcaaactaataatgaacaaccatcagctgctactcaagcaaacttaaagaaattaaat
cacgaagcagctaaagccgttcaaaatgctaagattgatgctggtagtttaacagatgaa
caaattaatgaattaaataaaattaacttctctaagtctgctgaaaaaggtgcaaaatta
acttttaaggacttagaaggaattggtaatgcaattgtaaaacaagacccacaatatgcc
gttccttactttaatgctaaggaaatcaagaatatgcctgcctcatatactgtcgatgcc
caaactggcaaaatggctcatcttgatgtttgggattcttggccagtacaagatcctgtc
acaggttatgtgtctaattacaagggttatcaactagttattgcgatgatgggtattcct
aatacaccaaacggtgataatcatatttaccttctttacaataaatatggtgataacgac
ttttcacattggcgtaatgcgggctcaatttttggtactaacgaaaataacgtataccaa
gaatggtccgggtcagctattgtaaatgataatggcacaattcaattattctacacttca
aacgatacctctgattacaagttaaacgatcaacgacttgctactgcaacactaaatctt
gatgtagatgataatggtgtagcaattaagagtgttgacaattaccatattttgtttgaa
ggtgatggtttccactatcagacctatgaccaatttgcaaacgggaaggatcgtaagaac
gacgattattgtctccgagatcctcacgttgtgcaatcagaaaatggtgatcgttactta
gtatttgaagccaatacgggaatggaagattaccaaagtgatgatcaaatttataattgg
gctaactatggcggcgatgatgcttttaatatcaagagtttctttaaacttctgaataac
aagaatgaccgtgaattagccagtttagctaatggggctattggtatcctaaagcttaac
aatgaccaaaccaatccaaaggttgaagaggtttattcaccattagtatccacattaatg
gctagtgacgaagttgaacgagtaaacgtagttaagcttggtgataagtattatctcttc
tccgcaactcgtgtaagtcgtggttccgatcgtgaattaaacgctaaagatatcacaatc
gttggtgataatgttgctatgatcggttatgtttctgataacttgatgggtaagtacaag
ccattaaataactcaggtgtcgtattaactgcatcagtacctgcaaactggcgtactgct
acttattcctactatgcagtacctgtagaaggtcaccctgatcaagtactaattacttct
tacatgagtaacaaggactttgcttcaggtgaaggaaactatgcaactttggcaccaagt
ttcatagtacaaatcaatccagatgacacgacaactgtattagcacgtgcaactaaccaa
ggtgactgggtatgggacgactctagtcggaacgataatatgcttggtgttcttaaagaa
ggtgcagttaacagtgccgccttaccgggtgaatggggtaagccggttgactggagtttg
attaacagaagttctggcttaggcttaaagcctcatcaaccagttaacccaagtcaacca
acgacgccagcaacaccagttaacccaagtcaaccaacgacgccagcaaaaccagttcag
gctggtcaagcgacggctactaattttgtggaccaacggttgcctcaaactggtgaaaac
aatagtcaaagtcaaacaatgtcatttattggtattttgttggcaatgtttggaagttta
ctcggttttcttggtatcaagaaacgtcgtaatgattaa

DBGET integrated database retrieval system