KEGG   Lactuca sativa (garden lettuce): 111881980
Entry
111881980         CDS       T05352                                 
Name
(RefSeq) beta-amyrin 28-monooxygenase
  KO
K22620  beta-amyrin 16beta-monooxygenase [EC:1.14.14.63]
Organism
lsv  Lactuca sativa (garden lettuce)
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lsv00199]
    111881980
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.63  beta-amyrin 16beta-monooxygenase
     111881980
Cytochrome P450 [BR:lsv00199]
 Cytochrome P450, plant type
  CYP716 family
   111881980
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 111881980
NCBI-ProteinID: XP_023734121
Position
5:complement(118938312..118941017)
AA seq 479 aa
MDTLLLVSSIVLPIITIFFLHHFLSQKSTIPGNYGWPLIGESIDYFKKLRSGTNEKFVMQ
RRKLFGDVFKTSILGEKMAFLCGPEGNKFLFSNENKLVEVWWPSSVESIIKKSNNKSVTA
ESAKVRQLLPPFLRAHAVKNYISDMDSELRQHLEDYWTGRDEVEVCPFVAKYTFALAVKL
LLGVHDATELEKLATPFVEAAGGIIAVPINIPGTRFNRGVKASNRIREVIMGIIAQRRKD
LADGTATPMQDLLSHMIVEVDKRNQDSGNAPTTDGDMSSDLLGLLIGGYDTINTTVVFIM
MTLVDHPDVYQGVLKEQMDIAREKSPGQLLDWDDLRKMKYSWNVACEVLRMRPPTVGAFR
VAKTDFTYAGFKIPKGWKLHYLPHYTQKNHEFFPNPEKFDPSRFEGVGPAPYTFVPFGGG
ARMCPGNEYARAEILVFMYNIITRYNWVRLIPDEKVVIDPLPRPVHGLPIKLIPHGTIY
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggataccctcctgctagtttcttccatagttttaccgatcatcaccatcttctttctg
caccattttctgagccaaaaatcaaccatccctggaaactatggatggcctctcatagga
gaaagcatagattacttcaagaagctccgcagtggcaccaacgagaagtttgtcatgcag
cgaagaaaactattcggcgacgttttcaagacgtcaatcctcggcgagaaaatggcgttc
ttgtgtggcccagaaggcaacaagttcctgttctcaaacgaaaacaagctcgttgaagta
tggtggccgagttccgtcgagagtatcatcaagaaatcaaataacaagtctgtcacggcg
gaatccgccaaagtccggcaactgttgccgccgttcttgagagctcatgcggttaaaaac
tacatctccgatatggattctgaactgagacagcatttggaggattactggactggacgt
gatgaggttgaggtttgcccatttgttgccaagtacacgtttgcattggctgtaaagttg
ctgttaggtgtccatgacgcgacggagttggagaagcttgcgacgccgtttgtggaggca
gccggtggaattatagcggttccgattaacatcccaggaacaaggtttaaccgtggagtt
aaagcgtcaaacaggatccgagaagtgattatgggcataattgcgcaaagaaggaaagac
cttgctgatgggactgctactccgatgcaagatttgctttcgcatatgattgttgaagtt
gacaaacggaaccaggactccggcaatgctccaaccactgacggtgacatgtccagtgac
ttattagggttgctcatcggtggctatgacactatcaataccaccgtcgttttcatcatg
atgactctagtcgatcaccccgacgtgtaccaaggagtcctaaaagaacaaatggacatc
gcaagggaaaaatcacccggtcagctgttggattgggatgatctacgtaagatgaaatac
tcatggaatgtcgcatgtgaagtgctacgaatgcgtccaccaactgttggtgcttttaga
gttgcgaaaaccgatttcacctatgctggtttcaaaatccccaaaggatggaaattgcat
tacctcccacattacactcagaaaaaccatgagtttttccctaatcctgagaagtttgat
ccctcaagatttgaaggagtgggacccgcaccttacacgtttgtgccatttggaggaggt
gcgaggatgtgtcctggaaatgagtatgcgagggcggaaatattggtgtttatgtacaat
ataataacaagatacaactgggtgaggttaattcctgatgaaaaggtggtaattgatcca
cttccaagaccagttcatggacttccgatcaagctcattcctcatggaaccatatattaa

DBGET integrated database retrieval system