KEGG   Lactobacillus taiwanensis: H1A07_06090
Entry
H1A07_06090       CDS       T07177                                 

Name
(GenBank) glycoside hydrolase family 68 protein
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
lta  Lactobacillus taiwanensis
Pathway
lta00500  Starch and sucrose metabolism
lta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    H1A07_06090
Enzymes [BR:lta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     H1A07_06090
SSDB
Motif
Pfam: Glyco_hydro_68 Gram_pos_anchor
Other DBs
NCBI-ProteinID: QTQ39430
Position
complement(1264770..1267046)
AA seq 758 aa
MGTLSTAAIVLSASTANAATTNADNVDNVNVSQVTTINAPASVTKNDNSELKEDTTNKKV
ARTETNTSLNSSKEINSQVNESKEDSSSAQVGSAPVSTDNGKEENSSDLNQDSNNISDHF
KDNDAQGQSSNSSAKTELKGKIKEVINNSGVDVTKLTNDQINNLNKVNFDDEPQDGTKLT
LNDLDAIGQALVRRDPKYAVPYFNAKEIKNMDAGVTKDAQTGKTETLEIWDSWPVQDPIT
GYVSNYKGYQLVVAMMGMPKKNDNHIYLLYNKYNDNEFSHWKNAGSIFGYNETPDLQEWS
GSAIVNKDGSIQLFYTKNDTSDGKLNDQQLATANLKLNVNNNGVSIASVDNDHVIFIGDG
KNYQTYDQFANGENRNRDNYTLRDPHVVEEKNGDRYLVFEANTGSNNYQSKDQIYRWANY
GGNDKFNINNFLSYFDNKDDQALASVANGALGILKLSGNQNNPTVKLDDVYSPLVTSLMV
SDEMERPDIVKVGNKYYLFSATRLSRGTKGEITRLANKIVGDNVAMIGFVSDSLTHGYVP
LNGSGAVLTASVPANWRTATYSYYAVPIKGKDNQLLITSYMTNRGEVAGKGNNSTWAPSF
ILQLNPDNTTTVLAKLTNQGVWVWNGDSENKNMIGTLEKDSSNSAALDGEWGKFIDWDAI
NSYSLKPHQPVTPPDTPDIPDIPPTPNTPDTPHTPTTLNTPDTPRTPEVPTTPVKKTTQS
ELPKAGAKDGIAAAILGAVSSMLGAIGLAGISKRKRNN
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgggaactttatctactgcagcaattgtattaagtgcttcaactgcaaatgctgccact
actaatgcagacaacgttgataatgttaatgttagtcaagttactacaataaatgcacct
gcttcggttacaaaaaatgataatagtgaattaaaagaggatactacaaacaaaaaagta
gctagaactgagacaaatactagtttgaattctagtaaagaaataaatagccaagttaat
gaaagtaaggaagacagctcatcagcacaagtaggaagtgctccagtttctaccgataat
ggtaaagaggaaaattctagtgatttaaaccaagattctaataatatttccgatcatttt
aaggataatgatgctcaagggcaaagttcaaactcttcagcgaaaaccgaattaaaggga
aaaatcaaggaagttattaataattctggtgttgacgtcacaaagctaactaatgatcaa
attaataatttaaataaggttaattttgatgacgagccgcaagatggaactaaattaaca
ttaaacgacttagatgcaattggacaagctcttgtaagaagagatccaaaatatgcagtt
ccatattttaatgcaaaagaaataaaaaatatggatgcaggtgtgactaaggatgcacaa
actggtaaaactgaaaccttagaaatttgggattcttggccagtacaggatcctataact
ggttatgtatcgaactataagggctaccaacttgttgttgcaatgatgggaatgcctaag
aagaacgataatcatatctatcttttgtataataaatataatgataatgaattctcacat
tggaaaaatgcaggttctatttttggatataatgaaactcctgatttacaagaatggtca
gggtcagctattgtaaataaagatggttctattcaattattttatacaaaaaatgatact
tcagatggtaagctaaatgatcaacagttggctacagctaatttgaaattaaatgttaat
aataatggtgtttcaattgctagtgttgataatgatcatgtgatttttattggtgatggt
aaaaattatcaaacttatgatcaatttgcaaacggtgaaaatagaaatagagataattat
acattacgtgatcctcatgtagtagaagaaaaaaatggtgaccgttatttagtatttgaa
gcaaacactggaagcaataattaccaaagtaaagatcaaatttatagatgggctaattat
ggtggaaatgacaaatttaatatcaataatttcctgagctactttgataataaagatgat
caagctcttgcttctgtcgctaacggtgcgctggggattttgaaattaagcgggaatcaa
aataatccaactgtgaagttagatgatgtttactcacctttagtaacgtcattaatggtt
agcgatgaaatggaaagacctgacattgttaaagttggaaataagtattatctattttca
gcaacaagattgtctcgaggaactaaaggtgaaattactcgtcttgctaataagattgtc
ggggataatgtagcgatgattggttttgtttctgacagcttaacacatgggtatgtacca
ttaaatggttctggtgctgtattaactgcatctgtccctgcaaattggcgtacggcaact
tattcgtattatgcagttcctatcaaaggaaaagacaatcagcttttaattacgtcttat
atgactaatcgtggtgaagtagctggaaaaggtaacaattcgacttgggcaccaagcttt
atcttgcaacttaatccagataatactactactgttttagccaaattaactaatcaaggt
gtttgggtttggaatggtgatagtgaaaataagaatatgattggtactcttgaaaaggat
tcttcaaatagtgctgctttagatggagaatggggaaagtttattgattgggatgcaatt
aatagttatagtttgaaaccacatcaacctgtgacaccaccagatacgccagacattccg
gatataccaccaacaccaaacacacctgacaccccacatacaccaacaacactaaacaca
cctgacactccacgtactccagaggttccaacaactccagttaagaaaactactcagtca
gaacttccaaaggcaggagctaaagatggtattgctgcagcaattttaggtgctgtaagc
tcaatgttaggagctatcggtttagcgggtatttcaaaacgcaagcgtaataactaa

DBGET integrated database retrieval system