KEGG   Lachancea thermotolerans: KLTH0F16038g
Entry
KLTH0F16038g      CDS       T01117                                 

Name
(RefSeq) KLTH0F16038p
  KO
K10868  DNA repair protein XRS2
Organism
lth  Lachancea thermotolerans
Pathway
lth03440  Homologous recombination
lth03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:lth00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    KLTH0F16038g
   03450 Non-homologous end-joining
    KLTH0F16038g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lth03400]
    KLTH0F16038g
DNA repair and recombination proteins [BR:lth03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     KLTH0F16038g
   NHEJ (non-homologous end-joining)
    MRX complex
     KLTH0F16038g
SSDB
Motif
Pfam: NIBRIN_BRCT_II FHA DUF848 Yop-YscD_cpl FHA_2
Other DBs
NCBI-GeneID: 8293114
NCBI-ProteinID: XP_002554883
UniProt: C5DJF7
Position
F:1302028..1304406
AA seq 792 aa
MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK
LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLAIT
ESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDFVSQF
ADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGSGNLWL
CGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLKNKARSLGFKT
RDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIAGSQVLADIVADAPNLRNKRKRA
NRQIQPLNSLAFFGGGSSLSQKLEQVSTPAKEQNLELQEGLGVHTNPEVHPLSKKPREEK
NTLHSAGNNSTTTFSETPIHQEDVQIGSEPLNHSAAHSVISKEDESTHTDERNKTLVNSA
KDARTVTFPSIHKNELKSSRTLSNEAKVEGNISHADTEVQAIKRPRSLIQAFQEAKQHEV
HRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPENSNQRILTNPQWARRKN
FKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPYDGTRNNSADDGFGDACQQH
AAAEQSNLTASPGNLALLGVEVENGPAFAFQSQRAANSQANSLFNETDNRRVEERSPERN
QELFVVDEDDSQPQVACYSNNVSQVPSRLEDADQSLQPDERRVPRVASLRNTVQHESDDS
DDEPQFRFQSRR
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgtggattctgcgataccagtatatcgatgaaactggctcagaaatcagagtttcttgc
tgcctaaaaaagggcactcaatatgtcgttgggcgctcggttaagagccctcttcaaatt
aaaggcgataaaagtatatcaagaaaacatgtccagctggaggtcaggcaaaattcaaag
ctcgaagtcctaaatgcgggaaagcttaccaaaattggtggggataacgtgaagatggac
caaatgttggagttcggtgctgatcaaagtgtcgcactggaaatgggagcagggcccgtg
aaaggtacagtcacttatgaaccggcaatttggaaaataccacacgacctagctattaca
gagagcttgaaaaatcatctatcgctctatgacatacaagttactaattctctcacttcc
aaaaccagtgttcagatcatcaaagaacaccagaagtcgcacggaaactgcttgtttgcg
ctagttaaaaaaatacccattatgtgtgagggcttcattggtgactttgtttcacaattc
gcagacacgcaaatcgacttcgatgctaaatgggaacagattactttaaaaaacgctccg
tttttagaacttcagactaaagatgcagctttcaaagggttgaacttcgtggtcactaac
caaaagacattcgccatttacaagagtattattgacgcaggctctggaaatttgtggcta
tgcggtgacgtatccaaccttggtacctttatagaaaagcaaatcaagtcagagaacgtg
gttattctgatacacctcatcgaagaagcacctgcgcttgcttcggagcaaaacaactct
atgcatatccaggaagccaagctactcaaaaacaaggcacgaagtttgggctttaaaact
cgtgatgtgaatgatattgttgatgcagttcttaaaaacgatatactgagtttgctagac
cgagtaccgcaagaaaaggctttggaagaaaactcagcgggaggaagcattgcgggctcc
caggtgcttgctgatatagtcgccgacgctcctaacttgcggaacaagcggaaaagagca
aacagacaaattcagccactaaatagtcttgcgtttttcggtgggggatcttctctctca
caaaagttggagcaagtttctactcccgcaaaagagcaaaatcttgagcttcaagagggc
ttgggcgtgcacacaaatccagaagttcatcctttgtctaaaaagccccgtgaagaaaag
aatactctgcattctgctggaaacaattcaacaacaactttctctgagaccccaatacat
caagaagatgtccagattggttctgaacctttaaatcactcagcggctcattcagtaatc
tcaaaggaggacgaatctacgcatacggacgagaggaacaaaacgttggttaattctgct
aaagatgcgcgcaccgtgactttcccttctatacataagaacgaactcaaaagctcacgt
acgctctcaaatgaggccaaagttgaaggtaacattagccatgctgatactgaggtacaa
gctatcaagcgccccaggtctctcatacaggctttccaagaagctaaacaacatgaagtt
cacagactaaaaaaaaacatggctgatgttgggagtgaggagcttacagaagaagccatt
aataagctcgacaaccttgcttctgtagaaaaggtggacttgatgagaaggccaagtgaa
gtacctgagaattctaatcaacgcatattgacgaacccacagtgggctaggagaaagaat
ttcaaaaagtttgtgaaattgtggccatcacattcttctagaagcagcccagataatatc
actgatgctgttaggaataaagcttacctcataaccagagattatgtgtcactttgtcct
tatgacggtaccaggaataatagcgcagatgatggatttggcgacgcttgccaacagcat
gctgccgcggaacaatctaatctaacagcatcccccggaaatttggctttgttgggagta
gaggttgagaatggaccagcgtttgcttttcaaagccagcgtgccgccaactcacaggca
aattctctatttaacgagactgacaatcgcagagttgaggagaggagcccagaacgcaat
caagagctttttgtagttgatgaggacgactcgcaaccacaagtggcgtgctatagcaat
aatgtctctcaagttccatcaaggcttgaagatgcggatcaaagcctgcagcccgacgag
cgcagggtaccaagagtcgcttcgctaagaaatactgtccaacatgaaagtgacgacagt
gatgacgaaccccaatttcgctttcaatcgagaagataa

DBGET integrated database retrieval system