Luteolibacter sp. Populi: ABWK72_08430 Help Entry ABWK72_08430      CDS       T10555                                  Name (GenBank) hypothetical protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism lup  Luteolibacter sp. Populi Brite KEGG Orthology (KO) [BR:lup00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:lup03400]     ABWK72_08430 Enzymes [BR:lup01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      ABWK72_08430 DNA repair and recombination proteins [BR:lup03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     ABWK72_08430  Prokaryotic type     ABWK72_08430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  XDA96450 Position complement(2135571..2135822) Genome browser AA seq 83 aa AA seqDB search MPDILCHVFLARDFEGHPIETDEAKPLWCRLGDIPYDRMWKDDIHWLPLLLDDRSFHGRF VFSGEDVIWQDLELDVHWSPAPA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgccggacatcctttgccatgtcttcctggcgcgcgacttcgaagggcatccgatcgag acggacgaggccaagccgctatggtgccggctgggcgatattccctacgaccggatgtgg aaggatgatatccactggctgccgctgctgctggatgaccggagtttccacggccgcttc gtcttctccggggaagacgtgatctggcaagacctcgagttggacgtccactggagtccg gccccggcctga

All links   Gene (1) NCBI-PROTEINID (1) All databases (1) Download RDF

DBGET integrated database retrieval system