KEGG   Limosilactobacillus vaginalis: LV515_00455
Entry
LV515_00455       CDS       T06850                                 

Name
(GenBank) LPXTG cell wall anchor domain-containing protein
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
lva  Limosilactobacillus vaginalis
Pathway
lva00500  Starch and sucrose metabolism
lva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LV515_00455
Enzymes [BR:lva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     LV515_00455
SSDB
Motif
Pfam: Glyco_hydro_68 KxYKxGKxW_sig Gram_pos_anchor DUF4361
Other DBs
NCBI-ProteinID: QFS35038
Position
107555..109807
AA seq 750 aa
MYKVGKNWAVATLVSAGILMGATTVHADTTTVSATDNDVTTTQPVAVTPVETVSAENGAS
QPGTTEHPGDVAQPGKQINDQTTQTKDQYGLTPDAAKAVQDAGMDPAKLTQDQVTNLDKI
NFKKSGSDKTGTQMTYEQYRGIANDLINRDHRYSIPFFNAKEIQNMPASHTRDAETNEIA
DLDIWDSWPVQDANTGEVVNWNGYQLAVAMMGIPAKNDSHIYLLYNKYGNNNLADWKNAG
PIFGFNQNSLHQQWSGSATKNSDGTIELFYTDVDTSDHGLNNQRIAAANLTLTVNPDGTV
SINKVNNNHIIFAGDGYHYQTYAQWRATNKGADNVAMRDAHVIEVDGQRYLVFEASTGTE
NYQGEDQIYNWQNYGDNAKTNIENFFGILNNDDMTSRASWANAALGILRLNNDESNPKLA
EVYTPLVSAPMVSDEIERPDIVKLNGKYYLFAATRLNRGTGDDLWSKADKTIGDNVVMIG
YVSDHLTYGYKPLNGNGVVLTSSVPFNWRTSTYSYYAMPIAGDDSDVLITAYMTNRGYVA
GQGNRSTWAPSFLVKINNDGTTQVLSKATNQGDWIWDSSSENDKMLAKSIDEAKLKGEAV
PTRVPDLSSGSKKDDPDPVPGYQPGKGSWAVGPDDVAPELPEFPLPDKPTPTTPDRPEKP
TTPDPDNPGKPTSNTPGTPEQPLNPGQPVISGTPGTSDVPSGKPAIQQTNNVKNDPATLP
QTGNESGVVALYVGSLFALLGLAGIQKRVK
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtacaaagtgggtaagaattgggcagttgcgactttagtgtctgccggaattttaatg
ggggcaacgacagttcacgctgatacaacgacagtttctgcgactgataatgatgtaact
actactcaacctgtagcagttacacctgtggaaacagtatctgcagaaaatggtgcatcg
caaccaggtaccacagagcacccaggtgatgttgcccaacctggcaagcaaattaatgat
caaactactcagacaaaggatcaatatggattgactccggatgctgctaaggcggttcaa
gatgcagggatggatccagcaaagttaactcaagatcaggttaccaacttggataagatt
aactttaagaagagtggtagcgataaaaccggaacccaaatgacttacgaacagtaccgg
ggaattgcaaatgacttgattaatcgtgatcatcgttactcaattccattctttaatgct
aaggaaattcaaaatatgccagcaagccatactcgtgatgcggaaactaacgaaatagct
gatcttgatatttgggattcatggcctgttcaagatgcgaatactggtgaagtcgttaac
tggaatggttaccaactcgcagttgcaatgatgggaattcctgctaagaatgattcacat
atttacttgctatacaacaagtatggtaataataacctagcagactggaagaatgctgga
ccaatttttggctttaaccagaattcacttcatcaacaatggtcaggttctgcaactaag
aatagtgatgggacaattgaattgttctatacagatgttgatacatcagatcatggatta
aataatcaacgaattgctgctgccaatctgacacttacagttaacccagatggtactgtt
tcaattaataaagttaataataaccatattatttttgctggtgacggttaccattatcaa
acgtatgctcaatggcgcgccactaataaaggtgctgataacgttgcaatgcgtgatgct
cacgttattgaggttgatggtcaacgctacttggtctttgaggcctctactggtactgaa
aactaccaaggtgaagatcagatctataactggcaaaactatggtgataatgccaagaca
aatattgaaaacttctttggcattttaaataatgatgatatgactagccgggctagttgg
gctaacgcagctttagggattcttcgcttgaataacgatgaatcaaatccaaaattagca
gaggtttatactccattagtatctgctccaatggtttctgacgaaattgaacggccagat
attgtgaaattaaatggtaagtactacctgtttgccgcaacacggttaaatcgtggtact
ggtgatgatctttggtccaaggcggataagacaattggtgataatgttgtcatgattgga
tatgtttctgatcatcttacttatggttacaagccattgaacggtaatggtgttgtctta
acatcaagtgttccatttaactggcgaacttcaacatatagctactatgcaatgccgatt
gctggtgatgatagtgatgtattaattactgcctacatgaccaaccgtggttatgtagct
ggtcaaggtaatcgttctacctgggcaccaagtttccttgttaagatcaacaacgatggc
acgactcaagtattgtctaaagccaccaatcagggtgattggatctgggatagtagttca
gagaatgataagatgttggctaaaagcattgatgaagctaagctaaaaggagaagcagta
ccaactcgggtacctgacctgtcatctggatcaaaaaaggatgatccagatccagttcct
ggttaccaacctggcaagggctcatgggctgttggtcctgatgatgttgcacctgaattg
cctgaatttccacttccagataagccaacaccgactacaccagaccgaccagaaaagcca
accacgccagatccagataatccagggaaaccaacatcaaatacccctggtacaccagag
caaccattaaatcctggtcaaccagttatttcaggaactccgggtacttcggatgtaccg
agtggtaagcctgcaattcagcagactaataatgtcaaaaatgatccagcaacgttacca
caaaccggtaacgaaagtggagtagtagcactttatgtagggtcattatttgcactatta
gggcttgctggtattcaaaaacgcgtaaagtaa

DBGET integrated database retrieval system