KEGG   Martelella sp. AD-3: AZF01_18320
Entry
AZF01_18320       CDS       T04332                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
maad  Martelella sp. AD-3
Pathway
maad00626  Naphthalene degradation
maad01100  Metabolic pathways
maad01120  Microbial metabolism in diverse environments
maad01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    AZF01_18320
Enzymes [BR:maad01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     AZF01_18320
SSDB
Motif
Pfam: DSBA Thioredoxin_5 Thioredoxin_4 HTH_Tnp_1 Thioredoxin_2
Other DBs
NCBI-ProteinID: AMM86060
UniProt: A0A127CN29
Position
3982242..3982838
AA seq 198 aa
MTGRQLDFYFDFMSPFAYLAFHKVPELCKRYGLEFRPHVVNLPQLKLMAGNTAPPNVSLP
LKIRYLSKDLDRWAEKYGVPLIFPKSLASEKLNKAFLYALAKGEGEVFIRAGWDRVWGEG
ADLADPALLAELANRLGWSPESLSAWVSSQEAADQYEASTQAAHEAGVFGTPTMIVGDQM
WWGNDRLMFMERTLQQGL
NT seq 597 nt   +upstreamnt  +downstreamnt
gtgacaggtcggcagcttgacttttacttcgacttcatgagccccttcgcctacctggca
tttcacaaggtgccggagctctgcaagcgatacggactggaatttcgccctcatgtcgtg
aacctcccccaactcaagctcatggcggggaacaccgccccacccaatgtcagccttccg
ttgaagatccgctatctgagcaaggatctcgaccgttgggctgagaaatatggtgtgcct
ttgatcttcccgaagtcgctcgcctccgagaagctcaacaaggctttcctctatgcattg
gctaagggcgagggcgaagtcttcatccgcgctggttgggaccgggtctggggcgaaggt
gcagatctggccgaccctgcgttgctggctgaattggcgaatcgtttgggctggagtccc
gagtcgctttcggcttgggtttcttcgcaggaggccgcagaccaatacgaggctagcacg
caagctgcgcatgaggccggcgtgttcggtacgcccacgatgatcgtgggagatcagatg
tggtggggcaacgaccgcctcatgttcatggaaagaacgctccaacaggggctttga

DBGET integrated database retrieval system