KEGG   Methanosarcina acetivorans: MA_0150
Entry
MA_0150           CDS       T00080                                 

Symbol
ramA
Name
(GenBank) methylamine methyltransferase corrinoid activation protein
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mac  Methanosarcina acetivorans
Brite
KEGG Orthology (KO) [BR:mac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MA_0150 (ramA)
Enzymes [BR:mac01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     MA_0150 (ramA)
SSDB
Motif
Pfam: RACo_C_ter Fer4_6 Fer4 Raco_middle Fer4_21 Fer4_7 Fer4_9 Fer4_10 Fer4_16 Fer4_2 Fer4_17 Fer4_3 Fer4_4 Fer4_8
Other DBs
NCBI-ProteinID: AAM03603
UniProt: Q8TUC3
Position
178886..180508
AA seq 540 aa
MYGIALDLGTSGFRAQIIDLDTHETLKTVITMGHPLPGGNVMDHLDFAITTGEDVAHGVI
IETVRRMFLKFDADLSKVERLAVCGNPIQLSLFQNIEIRDLAYAGENKQKMLGVQDVKRD
ARVFLASELFGNDFLPDCEVIVPPAIKHEIGADALAMMLETDFLTQTEPALVTDYGTNAE
MALKVGDRIITASAAAGPAIEGQGISSGMLASPGAICDVKPEGEYWKILVLDREMEKREA
YLINPVSGEIKESNGYEVSGITGTGVISVFALALKSGLIEKPPKLPNGKLILGPGIEITE
KDVEEAGKAIGAIRAAHMTLIVESGIRYEDLEYAYMSGASGAYVDAEAARRLGAAPGYAR
KVVQFGNTSLALAWELVLDKSRLDDVIEIAKKITADHLMMATSDTFNNFYLCELSYWTMG
MPLEMYDQMLELYGLPKLPRTLEHADIEKRVSKDIEQVGVGGLAILKEIGIILEVSVDKC
IYCQKCVEECPEGALEIVETNGNRIAKYDSQKCLGTSCRRCVSICPENALDITKLKIKEK
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtacggaatagcacttgacctgggtaccagtggttttcgagcccagattattgatctt
gatacgcatgagaccttaaaaacagtcataaccatgggtcacccccttcctgggggaaat
gtcatggaccacctggattttgcaataacgaccggggaagatgtggctcacggtgtaatt
atcgaaaccgtcaggaggatgttcctgaaattcgatgccgacctgtcgaaagtggaaagg
cttgcagtctgtgggaaccctatccagctttctctttttcagaacatcgaaataagggac
ctcgcatacgccggggaaaacaaacagaaaatgctcggggttcaggatgtaaaaagagat
gcccgggtatttcttgcctcagaacttttcggaaacgattttcttcctgactgtgaagtg
atcgtgcctcccgcaatcaagcatgaaattggggctgatgcccttgccatgatgctcgaa
accgatttccttacacagaccgagcctgcgcttgtgaccgattacgggacaaatgccgaa
atggctctcaaggtaggggacagaattataacggcaagcgctgctgcaggccctgcaatc
gaagggcaggggatcagttccggtatgcttgcaagcccaggggcgatttgcgatgtgaag
cctgaaggcgaatactggaaaattctggtgcttgacagggagatggaaaagagagaagct
tacctgatcaaccctgtaagcggtgagataaaagagtctaacggatatgaggtttcaggc
attacaggaacgggagtgatctcggtttttgctcttgcgttgaaaagcgggttgattgaa
aagcctcccaaactccctaacggaaaactgattctgggccccggaatcgagattactgaa
aaggatgtcgaagaagccggaaaagccataggagcaatccgggctgctcacatgacccta
atagtggaatccggaatcaggtacgaagaccttgagtatgcgtacatgtcaggggcttcc
ggagcctatgtagacgccgaagctgctcgcaggctcggggctgccccgggatatgccaga
aaagtcgtacagttcggaaacacctctctcgcccttgcctgggaacttgttctggacaaa
tccaggctggacgacgttatagagatagcaaaaaagattactgccgaccacctgatgatg
gcaactagcgatactttcaacaacttctacctctgcgaactttcctactggaccatgggc
atgcccctcgaaatgtacgaccagatgcttgaactctacggcctgcccaaacttccccgg
accctcgagcacgctgacatagaaaagagggtgagtaaggacatagagcaggtcggagtt
ggcggacttgccatcctcaaagaaataggcataatcctcgaagtctctgtggacaagtgc
atctactgccagaaatgcgtagaagaatgccctgaaggcgccctcgaaatagtagaaacc
aacggtaacagaatcgcaaaatacgacagccagaaatgcctgggcacaagctgccggcgc
tgtgttagcatctgtcccgaaaacgccctcgatatcacgaaactcaaaataaaggaaaaa
taa

DBGET integrated database retrieval system