KEGG   Methanococcus aeolicus: Maeo_0359
Entry
Maeo_0359         CDS       T00552                                 
Name
(GenBank) conserved hypothetical protein
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mae  Methanococcus aeolicus
Brite
KEGG Orthology (KO) [BR:mae00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Maeo_0359
SSDB
Motif
Pfam: DUF2109 PhrC_PhrF
Other DBs
NCBI-ProteinID: ABR55946
UniProt: A6UTX4
Position
378895..379140
AA seq 81 aa
MDIASITIEIIAIIIAVKVFITRSRALKLLYICNLNFCIAGLIALYIKSPMGALVAMAYF
VFSTISSNAIAHSIGEIKKIK
NT seq 246 nt   +upstreamnt  +downstreamnt
atggatattgcctcaattacaattgaaattattgctattattatagctgttaaagtattt
attactcgaagtagggctttgaaattgttgtatatctgcaatttaaatttttgtattgca
ggtttaatagctttgtatataaaaagcccaatgggagctcttgtagctatggcatatttt
gtgttttccacaatttcctccaacgccattgcccatagtataggagaaattaagaaaata
aaatag

DBGET integrated database retrieval system