KEGG   Mesorhizobium australicum: Mesau_02094
Entry
Mesau_02094       CDS       T02417                                 

Name
(GenBank) Zn-dependent hydrolase, glyoxylase
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
mam  Mesorhizobium australicum
Pathway
mam00750  Vitamin B6 metabolism
mam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mesau_02094
Enzymes [BR:mam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     Mesau_02094
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2
Other DBs
NCBI-ProteinID: AGB44536
UniProt: L0KHQ0
Position
2155947..2156753
AA seq 268 aa
MSDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMK
VLPFEKPIQEKHQTIPGALALLGLEPKDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEV
PQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLAGTTRANSTFEGIEGDIELAKGVKLI
STPGHSIGHYSLLVEFPKRKPIMFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRRVKKL
AEDHGAELMYSHDMDNFKTYKTGTQFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcggataccaaggtctacctgcttgacggcggctcacttgtcctcgacggctatcat
gtgttctggaaccgtggcccaggcggcgaagtgcgcttccccgtctattcgatcctgatc
gagcatgccgagggccgcttcctcatagataccggctatgactacgaccacgtcatgaag
gtgctgcccttcgagaagccgatccaggaaaagcaccagaccattcccggcgcgctggcg
ctgctcgggctggagccgaaggatatcgacgtggtcgtcaactcgcacttccatttcgac
cattgcggcggcaacaagtactttccgcatgccaagaagatctgccaccgttcggaggtg
ccgcaggcctgcaatccgcagcccttcgaacatctcggttattcggacctgagcttctcg
gcggaagcggcggaggcacgtggcgcgaccgcgcaactgctggcaggcacaacacgggcc
aactcgactttcgagggcatcgaaggtgacatcgaactggcaaaaggcgtgaaactgatc
tccacccccggccactcgatcggccattacagccttctggtcgagtttcccaagcgcaag
ccgatcatgttcacgatcgacgccgcctacacgcagaagagcctggaaacgctttgccag
gccgccttccatatcgacccggtcgcgggcgtcaattcgatgcgcagggtgaagaaactt
gccgaggatcacggcgccgagctgatgtactcgcacgacatggacaacttcaagacctac
aaaaccggcacacagttctacggctga

DBGET integrated database retrieval system