KEGG   Massilia violaceinigra: CR152_21625
Entry
CR152_21625       CDS       T05157                                 

Name
(GenBank) monooxygenase
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
mass  Massilia violaceinigra
Pathway
mass00404  Staurosporine biosynthesis
mass01100  Metabolic pathways
mass01110  Biosynthesis of secondary metabolites
mass02024  Quorum sensing
Module
mass_M00808  Violacein biosynthesis, tryptophan => violacein
Brite
KEGG Orthology (KO) [BR:mass00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    CR152_21625
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CR152_21625
Enzymes [BR:mass01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     CR152_21625
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase NAD_binding_8 DAO Pyr_redox_2 SE Pyr_redox FAD_binding_2 GIDA HI0933_like Sacchrp_dh_NADP ApbA FAD_oxidored 3HCDH_N TrkA_N Glyco_transf_4 UDPG_MGDP_dh_N Epimerase NAD_binding_9 Lycopene_cycl
Other DBs
NCBI-ProteinID: ATQ76829
UniProt: A0A2D2DPD7
Position
complement(5020375..5021664)
AA seq 429 aa
MHKIIIVGGGLAGSLTATYLAQRGHEVHVIEKRGDPLRAESANADPVNSRAIGVSMTVRG
IKAVLAAGISKEELDRCGEPVVGMAFSVGGGHKVRELTPLEGLFPLSLDRTAFQRLLNKY
AVMHKVNYYFEHKCLDLDLDKKSVLIQGPDGALRHLQGDLIIGADGAHSAVRRAMQAGMR
RFQFEQSFFRHGYKTLVLPNAAGLGFRKDLLYFFGMDSKGQFAGRAATIPDGSISFALCL
PYTGTPSLATRDRAAMGEFFSRYFGILPPASREELVNQFIALPSNDLINVRSSTFHYKSN
VLLIGDAAHATAPFLGQGMNMALEDVYVFITLLEKHRDDLGLVLSEFTGQRKVQADAMQD
MAIANYEMLSNPNFIFFLQTRYTRYMHKKFPSVYPPDMAEKLYFTSVPYDVLQQIQKKQN
VWYKLGRVN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgcacaaaatcatcatcgtgggcggcggcctggcgggcagcctgaccgccacttatctg
gcgcagcgcggacatgaggtccacgttatcgaaaagcgcggcgatccgctgcgggcggag
tcagccaacgccgatccggtcaactcgcgcgccattggcgtgagcatgaccgtgcgcggc
atcaaggcagtgctggcggccggcatcagcaaggaggagctcgatcggtgcggcgaaccg
gtcgtcggcatggcattttcggtcggcggcggccacaaggtgcgcgaactgaccccgctc
gaaggcttgtttcccttgtcgctggaccgcaccgcgttccagcgcctgctgaacaagtac
gccgtcatgcacaaagtgaactattacttcgagcataaatgcctggacctggacctggac
aagaaatccgtgctgatccagggcccggacggcgccttgcggcatctgcaaggcgacctg
atcatcggggccgacggcgcccactccgccgtgcggcgcgccatgcaagccggcatgcgg
cgcttccagttcgaacaatccttcttccgccacggctacaagaccctggtactgccgaac
gccgcgggactgggcttccgcaaggatctgctgtatttcttcggcatggattccaagggc
cagtttgccggccgcgcagccaccatcccggacggcagcatcagcttcgccctctgcctg
ccctacaccggcacgcccagcctggccacgcgcgaccgcgccgccatgggggagtttttc
agccgctacttcggcatcctgccaccggccagccgggaagagctggtgaatcagttcatc
gcgctgcctagcaacgacctcatcaatgtccgctccagcaccttccattacaagagcaat
gtcctgctgatcggcgatgcggcgcatgcgaccgcccccttcctcggtcagggcatgaac
atggcgctcgaagacgtctacgtcttcatcaccttgctggaaaagcatcgcgatgacctg
ggcctggtcttgtcggagtttacggggcagcgcaaggtgcaggccgacgccatgcaggat
atggcgatcgccaactacgaaatgctgagcaacccgaattttattttcttcctgcaaacc
cgctacacccgctacatgcacaagaaatttcccagtgtttatccgcccgacatggcggag
aagctgtacttcacatcggttccctacgatgtgctgcaacaaatccagaagaagcaaaac
gtttggtacaaacttggaagggtaaactaa

DBGET integrated database retrieval system