KEGG   Massilia sp. WG5: AM586_27545
Entry
AM586_27545       CDS       T04122                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
masw  Massilia sp. WG5
Pathway
masw00626  Naphthalene degradation
masw01100  Metabolic pathways
masw01120  Microbial metabolism in diverse environments
masw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:masw00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    AM586_27545
Enzymes [BR:masw01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     AM586_27545
SSDB
Motif
Pfam: DSBA DUF6098
Other DBs
NCBI-ProteinID: ALK99990
Position
unnamed_1:36449..37033
AA seq 194 aa
MLDFYFDFVSPFSYLANIRLAGIVQRYDIAVSYRPIEIGAAKRAIGNVGPSNRDMPVKLS
HLSKDLQRWAQRYGAPLEFPPSFDARRLNTGFFYAAGKGRQAEYVSRAFHLTWGLGQAFG
DEKVLREVASGWNVDEFIRYTDSEDGAHAYKKSTDEGIARQVFGVPMVVIGEEMWWGNDR
LDFVAEYLESRKSN
NT seq 585 nt   +upstreamnt  +downstreamnt
atgctggatttttattttgatttcgtcagtccgttctcctatctcgccaacattcggttg
gccgggattgtgcagcgctatgacattgcggtttcttacaggccgattgaaattggagct
gccaaacgcgcgattggcaatgtgggaccgtcgaaccgggatatgcctgtcaagttatcg
cacctgtcgaaggatctgcagcgctgggcgcaacggtatggggcgccgctcgagttccct
ccaagcttcgacgcccggcgtttgaacaccggcttcttctatgctgcgggaaaaggtcgc
caggccgagtacgtcagccgcgcttttcacctgacctgggggctggggcaagcgtttggc
gatgagaaggtgttgcgggaggtcgcttccggctggaatgtcgatgagttcatacggtac
acagattcagaggacggcgcgcatgcatacaagaagtcgaccgacgaaggcattgctcgc
caggtcttcggcgttccaatggtggtgatcggagaagaaatgtggtggggaaatgaccgc
ctggacttcgtcgctgaatatctggaatcgcggaagtcgaactga

DBGET integrated database retrieval system