KEGG   Micromonospora aurantiaca: Micau_4000
Entry
Micau_4000        CDS       T01296                                 

Name
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K15944  nogalaviketone/aklaviketone reductase [EC:1.1.1.- 1.1.1.362]
Organism
mau  Micromonospora aurantiaca
Pathway
mau01057  Biosynthesis of type II polyketide products
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
Module
mau_M00781  Nogalavinone/aklavinone biosynthesis, deoxynogalonate/deoxyaklanonate => nogalavinone/aklavinone
Brite
KEGG Orthology (KO) [BR:mau00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    Micau_4000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:mau01008]
    Micau_4000
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.362  aklaviketone reductase
     Micau_4000
    1.1.1.-  
     Micau_4000
Polyketide biosynthesis proteins [BR:mau01008]
 Polyketide tailoring proteins
  Others
   Micau_4000
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Sacchrp_dh_NADP RmlD_sub_bind LDcluster4 Polysacc_synt_2
Other DBs
NCBI-ProteinID: ADL47523
UniProt: D9T297
Position
4542191..4542958
AA seq 255 aa
MGNGNKSALRRSIVITGGGTGIGRAVARGFAEQGDDVLIVGRTAASLRDTAEGYPGIRTS
VADITAPGAPQAVVDAAQQAYGRIDVLVNNAATSVAKLLADTTEEEIQSQFATNVMAPIH
LTRCALEPLAASRGVVVNISTAGALGQRTWPANGAYGASKVALDFLTRTWAVEMAPHGIR
VVGIAPGVADTGIGVRSGMTEEQYADFLKWMADRAPAGRVGTPEEIATWVRKLVEPDAGY
LTGVVIPIDGGLSLT
NT seq 768 nt   +upstreamnt  +downstreamnt
atgggtaatgggaacaagtccgcgctgaggcgcagcatcgtcatcaccggcggcggcacc
ggcatcggccgcgccgtggcccgcgggttcgccgagcagggcgatgacgtcctgatcgtc
ggccgtactgcggcgagcctgagggacaccgccgagggttacccgggcatccggacgtct
gtcgccgacatcaccgctcccggcgcaccgcaggccgtcgtcgacgcggctcagcaggcg
tacgggcggatcgacgtcctggtcaataacgccgccacgtcggtcgcgaagctcctcgcc
gacaccacggaggaggagatccagtcgcagttcgcgacgaatgtcatggcaccgatccac
ctgacgcggtgtgctctcgaacccctcgcggccagccggggcgtggtggtcaacatcagc
acggcgggcgcgctcggccagcggacgtggcccgccaacggggcgtacggcgcgagtaag
gtggcgctggacttcctgacccgcacctgggccgtcgagatggctccgcacgggatccgg
gtcgtggggatcgcgcccggtgtcgccgatacgggtatcggggtccgcagcggcatgacg
gaggagcagtacgccgacttcctcaagtggatggccgaccgtgcgccggcgggacgggtc
ggcacgccggaggagatcgccacttgggtgcgcaagctcgtcgagccggacgccggttac
ctgaccggcgtagtgatcccgatcgacgggggcctgtccctcacctga

DBGET integrated database retrieval system