KEGG   Methanosarcina barkeri Fusaro: Mbar_A0840
Entry
Mbar_A0840        CDS       T00271                                 

Name
(GenBank) conserved hypothetical protein
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mba  Methanosarcina barkeri Fusaro
Brite
KEGG Orthology (KO) [BR:mba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mbar_A0840
Enzymes [BR:mba01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     Mbar_A0840
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4_21 Fer4_6 Fer4 Fer4_7 Fer4_9 Fer4_2 Fer4_16 Fer4_10 Fer4_17 Fer4_4 Fer4_3
Other DBs
NCBI-ProteinID: AAZ69816
UniProt: Q46E76
Position
1:complement(1015751..1017373)
AA seq 540 aa
MYGIALDLGTSGFRAQLIDLEKKETLKTVITMGHPLPGGNVMDHLDFAITTGEDVAHEVI
IETIRRMFLRFDVDLSRVERLAVCGNPIQLSLFQNTEIRDLAYAGENKQKMLGVRNVKRD
ARVFPASEIFGENDLPNCEIIVPPAIKHEIGADALAMMLETDFLIQPEPSLVTDYGTNAE
MALKIGDRIITASAAAGPAIEGQGISSGMLASPGAICDVKPEGQYWRIIVLDREMEKQNA
YLIDPVTGEIKESYGFEAVGITGTGVISAFALALRSGMIEKFPKLPNGKLILGPGIEITE
KDVEEAGKAIGAIRAAHMTLIVESGIKYEDLEYAYMSGASGAYVDAEDARRLGAAPGYAK
KIVQFGNTSLALARELVLEESRLDDVIAIAKKITADHLMMATSETFNNFYLCELSYWTQG
MPLETYDQMLELYGLPPLPKTLEHVNIEKRVVKDIEEVGSGGLSILKEIGIILEVPVEKC
VYCKKCVKECPETALEIVEIDGHRIAKYDSQKCLGTSCRRCVSVCPEDAIDITKLKITAK
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtatggaatagcacttgatctgggcaccagtggttttagagcccagcttattgatctt
gaaaagaaggaaaccttaaagacagttataaccatgggtcatcctctccccgggggaaat
gtcatggatcacctggactttgcaatcacaacaggtgaagatgtggctcatgaggtaatt
atcgagaccatcagaaggatgttcctgcggttcgatgttgacctttccagggttgaacgg
cttgcagtttgtggaaaccctatccagctttcccttttccagaatactgaaataagggat
cttgcttatgcaggggaaaacaagcagaagatgcttggagtccggaatgtgaaacgagat
gcccgtgtgtttcctgcgtcggaaattttcggggaaaatgacctgcctaactgtgaaatt
atcgtaccccctgcaatcaagcacgagattggagctgacgccctggctatgatgcttgaa
accgattttcttatccagcccgaaccttcacttgtcacggattacgggacaaacgccgag
atggctctgaaaatcggggatcgaattatcactgcaagcgcagcagcaggacctgcgatt
gaaggacagggtataagttcaggcatgctcgcaagcccgggcgcgatctgcgatgtaaaa
cctgaaggacagtactggagaattatagttcttgacagggaaatggaaaaacagaacgct
tatcttatcgatccggttacaggggagataaaggagtcctacggattcgaagccgtcgga
atcacaggcacaggagttatttcggcttttgccctggcactgagaagcggtatgattgaa
aaatttcctaaacttccgaatggaaaactgattctgggtcctgggattgagatcactgag
aaggatgttgaagaagccggaaaagctatcggggcaatccgggctgcccatatgaccctg
atcgttgaatctggaatcaagtacgaagaccttgagtatgcatatatgtcaggagcctct
ggtgcctatgtggacgctgaggacgcccgcaggctcggagcagcaccgggttatgcaaaa
aaaattgttcagttcggaaatacctcgcttgcgcttgcccgggaacttgtgctggaagag
tccaggctggatgacgtaattgcgattgcaaagaaaattactgccgaccacctcatgatg
gcaaccagtgaaactttcaataacttctacctctgcgagctttcctactggacccagggt
atgccccttgagacgtatgaccagatgcttgagctctacggcctgcctcccctcccaaaa
actctcgaacatgtaaacatcgaaaagcgagtcgtcaaagacatagaagaggtcgggtca
ggtgggctttccatcctcaaagaaattggcataatccttgaagtcccggtggaaaagtgc
gtctactgcaaaaaatgtgtaaaagaatgccctgaaactgctcttgaaatcgtagaaata
gatggccatagaatcgcaaaatacgacagccagaaatgtcttggtacaagttgccgccgc
tgtgtcagcgtctgccctgaagatgctatcgatataacgaaactgaaaatcacagcgaaa
taa

DBGET integrated database retrieval system