KEGG Orthology (KO) [BR:mbb00001]
09100 Metabolism
09104 Nucleotide metabolism
00240 Pyrimidine metabolism
BCG_2710c (dut)
09111 Xenobiotics biodegradation and metabolism
00983 Drug metabolism - other enzymes
BCG_2710c (dut)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:mbb03400]
BCG_2710c (dut)
Enzymes [BR:mbb01000]
3. Hydrolases
3.6 Acting on acid anhydrides
3.6.1 In phosphorus-containing anhydrides
3.6.1.23 dUTP diphosphatase
BCG_2710c (dut)
DNA repair and recombination proteins [BR:mbb03400]
Eukaryotic type
Other factors with a suspected DNA repair function
Modulation of nucleotide pools
BCG_2710c (dut)
Prokaryotic type
BCG_2710c (dut)
154 aa
MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGL
VHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVE
LVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL