KEGG   Methanoculleus bourgensis MS2: BN140_3001
Entry
BN140_3001        CDS       T02189                                 
Symbol
ehaC
Name
(GenBank) membrane-bound hydrogenase subunit ehaC
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mbg  Methanoculleus bourgensis MS2
Brite
KEGG Orthology (KO) [BR:mbg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    BN140_3001 (ehaC)
SSDB
Motif
Pfam: DUF2109
Other DBs
NCBI-GeneID: 18506949
NCBI-ProteinID: CDM26139
UniProt: W6PW15
Position
1275970..1276212
AA seq 80 aa
MIALYLVAGVAVFAVARALIERNTGRKLPYVNVMNFAVAGALVLLLDHPLSLVAAAAYFV
GSTLEANAIASTYAGGGVKR
NT seq 243 nt   +upstreamnt  +downstreamnt
gtgatcgcgctctacctcgtggctggagttgcggtctttgccgtcgcgcgagccctcatc
gagaggaacaccggcaggaaactcccctacgtgaacgtcatgaacttcgccgttgccggc
gcgctcgtcctgctgcttgaccacccgctctccctcgttgcggcggcagcctacttcgtc
ggctccacgcttgaggcgaacgcaattgcgagcacctatgcaggaggaggagtgaagcga
tga

DBGET integrated database retrieval system