KEGG   Methanococcoides burtonii: Mbur_1370
Entry
Mbur_1370         CDS       T00341                                 

Name
(GenBank) conserved methanogen protein with ferredoxin domains
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mbu  Methanococcoides burtonii
Brite
KEGG Orthology (KO) [BR:mbu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mbur_1370
Enzymes [BR:mbu01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     Mbur_1370
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4_21 Fer4_7 Fer4 Fer4_6 Fer4_9 Fer4_10 Fer4_17 Fer4_16 Fer4_4 Fer4_2 Fer4_8 Fer4_3
Other DBs
NCBI-ProteinID: ABE52286
UniProt: Q12W90
Position
complement(1462262..1463884)
AA seq 540 aa
MYGIALDLGTSGFRAQLIDLESKKVLKTAITMKHPLPGGNVMDHLDFAIQIGEDVANEIM
LDTVKRIFDEFGVDPSLIKRLAVCGNPIQLSLFQNMEIRDLAYAGENKQKKLGVENVVRG
SRVFPANELFEGIMDLPNCTVIVPPAIKHEIGADALAMMIKTDFMDMDTPSMVTDYGTNA
EMAIKVGDKIITASAAAGPAIEGQGIKCGMLASPGAISDVTVEDGLWRVTILDESMTECK
GHLIDPVTGEIKESSDVVAKGVTGTGVISALALALECGIMKKIPVLPNGKLFLDEGIEIF
EKDIEEAGKAIGAIRAAQLTLMIESGTAYSDLDNMYMAGATGAYVDANKARKLGSCPNFA
HNIVQFGNTSVALARDLVLDESKLDEVIEMAHKITADHLMMATSTVFSNIYMCELSYWTQ
GMPIEMYNQMLEMYKLPPLPETFINPRIEKRVVKDIDEVGEGGLQIVSDLGIIIEEHAPE
CIRCGQCEVECPEDAIKIIERDGELYANYNSERCLGTSCRRCVAVCPVDAIHYKVITVKH
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtatggtatcgcattggatttgggaacaagtgggtttcgtgcccagttgatcgatctg
gaatctaaaaaggttctaaagacggctattaccatgaaacatccgctacctggcggaaat
gtcatggatcatctggatttcgctatccagattggagaagatgtggccaatgagataatg
ttggatacggtcaaaaggatatttgatgagttcggcgttgatccttctctcattaaaagg
cttgctgtttgtggaaatcctatacaactctcccttttccagaatatggagataagagac
cttgcttatgcgggtgagaacaagcagaaaaagttgggtgttgagaatgtggtcaggggt
tcaagggtcttccctgcaaacgaattgttcgaaggtataatggacctcccaaactgtact
gttatagttcctcctgcaataaaacatgaaatcggtgcagatgctcttgctatgatgatc
aagaccgatttcatggacatggacactccttcaatggtgactgattatggtaccaatgca
gagatggctatcaaggtgggcgataagatcataaccgctagtgcggcagcaggtcctgct
attgaaggtcagggcatcaaatgtggaatgctggcaagtccgggtgctatatcagatgta
acggttgaagatggtctgtggagggtcactatcctcgatgagtccatgaccgaatgcaaa
gggcatttgatagatcctgttacgggagaaatcaaagagtcttctgacgttgttgcaaaa
ggtgtgacgggtactggtgtcatttctgctctggctcttgcattggaatgtggtatcatg
aagaaaatacctgtgcttcccaatggtaaacttttccttgatgagggcatcgagatattt
gaaaaggatatcgaagaggccggtaaagcaattggtgctatcagggctgcacaacttacc
cttatgatcgaatcaggtactgcttatagtgaccttgataatatgtatatggctggtgca
acgggagcttatgttgatgcgaacaaggcgagaaaattgggttcttgtcctaattttgca
cataatatagtacaattcgggaacacttcagttgcacttgcaagagatcttgttcttgat
gagtccaagctcgatgaggttattgagatggctcataagatcactgccgatcacttgatg
atggcaacaagtacagttttctctaatatctacatgtgtgagctttcttactggacccag
ggaatgcctattgagatgtacaaccaaatgcttgagatgtacaaattgccccctctgccg
gaaactttcataaatcctcgtatagagaagagagttgtaaaggatatcgatgaagttggt
gaaggtgggcttcagatagtcagtgaccttgggataatcattgaagaacacgctcctgag
tgtattcgatgtgggcaatgtgaagtcgaatgtcctgaggatgctattaagataattgag
cgcgatggcgagctctatgcaaattataatagtgaaagatgtcttggcaccagttgcaga
aggtgtgtggcagtttgtccggtggatgcaattcactataaggttatcactgtcaaacat
tga

DBGET integrated database retrieval system