KEGG   Micromonospora carbonacea: HXZ27_06155
Entry
HXZ27_06155       CDS       T06722                                 

Gene name
rosL
Definition
(GenBank) class I SAM-dependent methyltransferase
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
mcab  Micromonospora carbonacea
Pathway
mcab00523  Polyketide sugar unit biosynthesis
mcab01100  Metabolic pathways
mcab01110  Biosynthesis of secondary metabolites
Module
mcab_M00797  dTDP-D-desosamine biosynthesis
Brite
KEGG Orthology (KO) [BR:mcab00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    HXZ27_06155 (rosL)
Enzymes [BR:mcab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     HXZ27_06155 (rosL)
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 NodS Ubie_methyltran Methyltransf_15
Other DBs
NCBI-ProteinID: QLD23841
UniProt: A0A7H8XJZ3
Position
1410926..1411648
AA seq 240 aa
MSMMYADAIAEVYDLIYQGKGKDYAAEAAELEALARARRPHARTLLDVACGTGLHLRHLA
GLFDDVGGIELAPDMLSIAQQRNPGAALHLGDMRTFDLGHRYDVITCMFSSVGHLATTAE
LDATLARFAAHLSPGGVAIVEPWWFPETFTPGYVGASLVEVDGRTISRVSHSVREGGATR
ITVHYLVASPGGGVRHFDESHLITLFERSDYERAFARAGFTTEYLTPGPSGRGLFVGVHP
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtccatgatgtacgcggacgccatcgccgaggtctacgacctgatctaccagggcaag
ggcaaggactacgcggcggaggcggcggagctggaggcgctggcccgggcccgtcggccg
cacgcccggacgctgctggacgtggcgtgcggcacggggctgcacctgcggcacctggcg
gggctcttcgacgacgtgggcggcatcgagctggcaccggacatgctgagcatcgcccag
cagcgaaaccccggggcggccctgcacctcggcgacatgcggaccttcgacctggggcac
cgctacgacgtcatcacctgcatgttcagttcggtgggccacctggccaccacggccgag
ctggacgcgacgttggcccggttcgccgcgcacctgtcccccgggggagtggcgatcgtc
gagccgtggtggttcccggagaccttcacccccgggtacgtgggcgcgagcctggtggag
gtcgacggccgtaccatctcgcgggtctcccattcggtgcgcgagggcggcgcgacccgg
atcaccgtgcactacctcgtggccagccccggcgggggagtccggcacttcgacgagagc
cacctgatcaccctcttcgaacggtccgactacgaacgtgccttcgcccgggcgggtttc
acgacggagtacctgacgcccggcccgtccggccgcggtctgttcgtcggcgtccacccc
tga

DBGET integrated database retrieval system