KEGG   Mycolicibacterium chubuense: Mycch_5445
Entry
Mycch_5445        CDS       T02150                                 

Name
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component
  KO
K22364  2-oxopropyl-CoM reductase (carboxylating) [EC:1.8.1.5]
Organism
mcb  Mycolicibacterium chubuense
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mycch_5445
Enzymes [BR:mcb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.5  2-oxopropyl-CoM reductase (carboxylating)
     Mycch_5445
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 Pyr_redox FAD_binding_2 DAO NAD_binding_7
Other DBs
NCBI-ProteinID: AFM20117
UniProt: I4BS60
Position
pMYCCH.01:106533..108092
AA seq 519 aa
MDLRNTVLSMDEWTELIHRAETGEISEPLENVDHDNTSPYDAIFVGGGAGGRFGSAYLQA
RGGRQLVVDKWPFLGGSCPHQACVPHHLFSEAAREMDYMRWNADTLWFGEFDDKRASIRD
LVELFKAGRNNPHAFMNWQSKEQLGMEYILNAEATVIDAHTVEVAGQRYTARNLVLATGA
RSYPPDIPGIELPGVYDFATLIEELDYEPSRCVIIGGSKIALEYGSFFQAAGCQTTIVSR
SPLMRTHSLHHVDEDLRTYVVDGMRKRGMDILEGAHPIEVIGNGKVTGVRMRLADGTEQT
IDTDFVFLGTGERPHSQPFVDALGVQVDDKGFIQVDSRMRTSVPGVYAIGDLIGAPMEMF
KARKCGMTAARNIMGEPYEFDFSEYPDFLHTTYEVTWVGLTEAEARQRYDDVAVIQMPPK
GIRDDELALPCSEGSMLYAFTRPELTGFQKAIYDSKTRRLLGAHHVGFGAKDAFQYLDHL
IRKGITVDEMGEMNELFINPDHFIQLSRLRAGQHNLTDL
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggacctgcgtaacaccgtgttgagcatggacgagtggaccgagctgatacaccgggcg
gagaccggggagatttccgagccgctggagaacgtcgaccacgacaacacctcgccctac
gacgcgatcttcgtcggcggcggcgcgggcggccggttcgggtcggcatacctgcaggcc
cggggcggccgccagctggtggtggacaagtggccgttcctgggcggctcctgcccgcac
caggcctgcgtgccgcaccacctgttctccgaggccgcccgggaaatggactacatgcgg
tggaacgccgacacactatggttcggcgagttcgacgacaaacgcgcctcgatccgggat
ttggtcgagctattcaaggccggccgcaacaacccgcacgcgttcatgaactggcagagc
aaggaacaactggggatggaatacatcctcaacgccgaggccacggtgatcgacgcacac
accgtggaggtcgccggccagcgctacaccgcccgcaacctcgtgctcgccaccggcgcc
cgcagctacccgcccgacatccccgggatcgagctgcccggggtgtacgacttcgccacc
ctgatcgaggaactggactacgagccctcccgctgcgtgatcatcggcggatccaagatc
gccctggaatacggctccttcttccaggccgccggctgccagaccaccatcgtctcccgc
agcccgctgatgcgcacccacagcctgcaccacgtcgacgaggacctgcggacctacgtc
gtcgacggaatgcgcaagcggggcatggacatcctcgagggcgcccacccgatcgaagtg
atcggcaacggcaaggtcaccggcgtgcgaatgcggctcgccgacggcaccgaacagacc
atcgacaccgacttcgtgttcctgggcaccggggaacgcccccactcccagcccttcgtc
gacgccctcggcgtacaggtcgacgacaagggattcatccaggtcgactcccggatgcgg
acctcggtgcccggcgtctacgccatcggcgacctcatcggcgcgccgatggagatgttc
aaggcccgcaaatgcggcatgaccgccgcccgcaacatcatgggcgaaccctacgaattc
gacttctccgaataccccgactttctgcacaccacctacgaggtcacctgggtcgggctc
accgaggccgaagcccggcaacgctacgacgacgtcgccgttatccagatgccacccaag
ggcatccgcgacgacgaactcgccctcccctgctccgaaggatcgatgctctacgccttc
acccgtcccgaactcaccggcttccaaaaagccatctacgacagcaaaacccgccgactc
ctgggcgcccaccacgtcggcttcggcgccaaggacgccttccaatacctcgaccacctc
atccgcaaaggcatcaccgtcgacgaaatgggcgaaatgaacgaactattcatcaacccc
gaccacttcatccaactctcccgcctccgcgccggacaacacaacctcaccgacctgtga

DBGET integrated database retrieval system