KEGG   Mycolicibacterium chubuense: Mycch_5976
Entry
Mycch_5976        CDS       T02150                                 

Name
(GenBank) methionine synthase II (cobalamin-independent)
  KO
K22363  2-hydroxypropyl-CoM lyase [EC:4.4.1.23]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00625  Chloroalkane and chloroalkene degradation
mcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycch_5976
Enzymes [BR:mcb01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.23  2-hydroxypropyl-CoM lyase
     Mycch_5976
SSDB
Motif
Pfam: Meth_synt_2 Meth_synt_1 NodZ
Other DBs
NCBI-ProteinID: AFM20580
UniProt: D2K2D7
Position
pMYCCH.02:31651..32760
AA seq 369 aa
MKVGATDVLLPTTMVGNYPNPRWYDGHGFAQFPKGEFVYDAISREAFEDAVLAIVHDQEA
AGLDIISDGKVYGGDSPYASIIYHYYERMSGFKPSGTNIGLPIYSTLYSPIVESEVRREH
PFHLATLRATRKATNKPVKVSYVGIQVLAAAATNKFYDEDRELGMAIAKAFKEDFQELEQ
NGCDIIQLDEFVWPYGIGDWEVEAINYAMDGISCDFWVHTCWGNYSGTPGYLPEENDKEF
GAWVLDKRTSESAQPERAAAIFPKVLETNITALNYEVGRTGPDDLKPLIDYNWNRPFVAG
VIDVKSTITETADEVADRIRSVLEFVPAEQLALSTDCGLVNLNRMVSASKLHALADGAAI
VRAELQGQQ
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaaggttggggcgactgacgtcctactgcccacgacgatggtcggtaactatccgaac
ccgcgctggtacgacggacatggattcgctcagttcccgaaaggcgagttcgtctacgac
gccatcagccgggaagcgttcgaagacgccgttctcgccatcgtgcatgaccaagaggct
gccggcctcgacatcatctcggacgggaaagtctacggcggcgattccccctacgcatcg
atcatctatcactactacgagcggatgagtggattcaaaccgtcgggaaccaacatcggt
ttgccgatctactccaccttgtattcacccatcgtggaatccgaagttcgtcgtgaacat
cccttccacctcgcgaccctgcgcgcaacgcggaaggcgaccaacaagccagtcaaggtg
tcctacgttggcatccaggtgctcgccgccgcggcaacgaacaagttctacgacgaggac
cgcgaactcggcatggctatcgcgaaggcgttcaaagaggacttccaagagctcgagcag
aatggttgcgacatcattcaactcgacgaatttgtctggccctacggaattggggactgg
gaagtcgaggctatcaactacgcgatggatggcatcagctgcgacttctgggtgcacacc
tgctggggtaactactcaggtacgccgggataccttccggaggaaaacgacaaggagttc
ggcgcctgggtgcttgacaagaggacttcagagtcggcacaacctgaacgtgcggccgcg
atctttccgaaggtgctggagaccaacatcaccgcgctgaactacgaagttggtcgcacc
gggcccgatgatctcaaaccgctaatcgactacaactggaaccgtcccttcgtcgccggc
gtcatcgatgtcaagagcacgatcaccgaaactgccgacgaagtcgcagacaggatccga
tcggtgctggaatttgttccggcagaacaacttgcactttccacggactgcggcctggtc
aatctgaacagaatggtttccgcgagcaagctgcacgcactggccgacggcgcagcaatc
gtccgggcagaactccaagggcagcagtga

DBGET integrated database retrieval system