KEGG   Mycolicibacterium chubuense: Mycch_5977
Entry
Mycch_5977        CDS       T02150                                 

Name
(GenBank) Methane/Phenol/Toluene Hydroxylase
  KO
K22354  alkene monooxygenase beta subunit [EC:1.14.13.69]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00625  Chloroalkane and chloroalkene degradation
mcb01100  Metabolic pathways
mcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycch_5977
Enzymes [BR:mcb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.69  alkene monooxygenase
     Mycch_5977
SSDB
Motif
Pfam: Phenol_Hydrox
Other DBs
NCBI-ProteinID: AFM20581
UniProt: I4BTH4
Position
pMYCCH.02:33079..34131
AA seq 350 aa
MAVSHIPPQRKALSGNRTFGWVTPKGKRPTEYEDLTVGQQSTPAQFAFQGWPLRFDNGRD
PYTEDSTVLRSSNWYAYRDPNQTMNRPYIAGVHEAEKALQNTFLGASAGGLFGFANREWV
SKGLAKHYMTYPFVEYGMFLALCYAEREALSDTVTFSIVFEAADKLRHLQDVVYYSFELA
EAHSEFSDEECLRVWKEDPVWQGAREAIENVIALDDWMEIVVALNLCFDPLFGELAKVEY
FTRFAGANGDLVTPSVIASSEADTVRTRAWTKELIRHLVEDPEYGTHNSSIIAAWVDKWN
RYSLKACDAFAPVFSEVPNQPTSYEDAMTEIREKQSQILNELNLDPVTAN
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggctgttagtcacattccaccgcagcggaaggcgctgtccggaaaccggacattcggc
tgggtgacgccaaaaggcaagcgtcccaccgagtacgaagatctgaccgtagggcagcag
tcgaccccggcgcagttcgcatttcagggctggccgctccgattcgacaacggacgcgac
ccctacaccgaagactcgacggtactgcgctcgtctaactggtacgcgtatcgcgatccg
aaccagacgatgaaccgtccgtacatcgctggcgtacacgaagctgaaaaagccctccag
aacacgttcctcggtgcgagtgcgggcggcctgttcggcttcgcgaaccgtgaatgggtg
agcaagggcctcgccaagcactacatgacgtaccccttcgtcgagtacggcatgtttctt
gcgctgtgttacgcagagcgcgaggcactttccgacacggtgacgttctctatcgtgttc
gaggccgccgacaaactgcggcacctgcaagatgtcgtctactactccttcgaacttgcc
gaggcgcactccgaattcagtgacgaggagtgcttgcgggtctggaaagaagacccggtt
tggcagggtgctcgtgaggcgatcgagaacgtcattgcgctcgatgactggatggagatc
gtcgttgccctgaacctctgcttcgatccgctgttcggtgaattggcgaaagtcgaatac
ttcacccgatttgcgggcgcgaacggcgacctggttacaccgtcggtcatcgcctcatcc
gaggccgacacagtgcggacccgggcgtggacaaaggaactcatccgccacttggttgag
gatcccgagtatggcacccacaactcgtcgatcattgcagcgtgggtggacaagtggaac
aggtactcgctgaaagcctgcgacgccttcgcccccgtgttctccgaggttcctaaccag
ccaacctcctacgaggacgcaatgaccgagatccgagaaaagcagtcgcagattctcaac
gaactcaacctcgacccggtaacagccaactag

DBGET integrated database retrieval system