KEGG   Mycolicibacterium chubuense: Mycch_5978
Entry
Mycch_5978        CDS       T02150                                 

Name
(GenBank) MmoB/DmpM family protein
  KO
K22355  alkene monooxygenase coupling protein
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00625  Chloroalkane and chloroalkene degradation
mcb01100  Metabolic pathways
mcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycch_5978
SSDB
Motif
Pfam: MmoB_DmpM
Other DBs
NCBI-ProteinID: AFM20582
UniProt: D2K2D9
Position
pMYCCH.02:34155..34484
AA seq 109 aa
MSSATPARDRTQVRDTVGISLIGSSETNVIVDMVAELLPDAKITDNDVFFKIERDEMLSF
DMVELSDRLGKPYTVHDFLVNMTSYYGRIVVKDHEIEIHSEILPERFRD
NT seq 330 nt   +upstreamnt  +downstreamnt
ttgtcatctgccacgcccgctcgggatagaacgcaagtccgcgacaccgtcggcatctcg
ctgatcgggagttcagaaaccaatgtcatcgtcgacatggttgctgagcttctccccgac
gccaagatcaccgacaacgacgtgttcttcaagatagaacgcgacgaaatgctgagcttc
gacatggttgaacttagcgaccgacttggcaagccgtatacggttcatgacttcctcgtc
aacatgaccagttactacgggcgaattgtcgtgaaggatcacgagatcgagatccactcg
gagatcctcccggaacgattccgcgactaa

DBGET integrated database retrieval system