KEGG   Mycolicibacterium chubuense: Mycch_5980
Entry
Mycch_5980        CDS       T02150                                 

Name
(GenBank) 2-polyprenylphenol hydroxylase-like oxidoreductase
  KO
K22356  alkene monooxygenase reductase
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00625  Chloroalkane and chloroalkene degradation
mcb01100  Metabolic pathways
mcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycch_5980
SSDB
Motif
Pfam: NAD_binding_1 FAD_binding_6 Fer2 NAD_binding_6 Fer2_4 DUF1707
Other DBs
NCBI-ProteinID: AFM20584
UniProt: D2K2E1
Position
pMYCCH.02:36152..37183
AA seq 343 aa
MGDTVTVQPFGDTFPVESGETVLSAILRNGRFVKYGCKHGGCSTCRAQVVEGEFTQSDGT
SFSLSDADRDAGVVLLCSTYADGDLVVDVGETMADLTEDEYNAGQDIVEFVGTVDRIVDY
TADIKGIEIALDEPSAISFVPGQYVEVLVPGSDDAWRSFSMANRPSDNSRVHLVVRVIPD
GRFTSQIGTTISAGTRLNLRGPLGQFAIRLSHRPIIFIAGGSGIAPVLSMLADLIEQNNQ
RRTTFLYGARTVADLPMLDELRQLSDELDWFTFIPALSQPDDTPWDGETGLITEVYHRNF
PSGHGHEAYLCGPPGMIDAALESLIASGCKERHIFFDRFVPSG
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgggtgacacagtaaccgtacagccgttcggtgacacgttccctgtcgaatcaggagag
acggtactgtccgcaattctccgaaatggcagattcgtaaaatacggctgcaagcacggc
ggatgcagcacctgccgagctcaggtcgtcgaaggcgaattcacccaatccgacggaacg
tcgttttccctgagcgacgctgaccgcgacgcaggtgtcgtgctgctctgctcgacatat
gcagacggcgacttggtcgtcgacgtcggcgagaccatggcagatctaaccgaagacgag
tacaacgccggccaagatatcgtcgagttcgtcggtacggtcgaccgcatcgtcgactac
acggcggatatcaagggcatcgagatcgccttggacgagccctcagcgatatcgttcgta
cccggccagtatgtcgaagtccttgtcccgggatccgacgacgcatggcggtcgttctcg
atggccaaccgaccgagcgacaactcgagggtgcaccttgtagttcgcgtgatccccgat
gggcggttcacctcgcagatcggtacgaccatctccgcggggacaaggctgaacttgcgc
ggcccattggggcagtttgcaattcgactatcacaccggccgataatcttcatcgcggga
ggttcgggtattgccccggtactttcgatgctcgctgaccttatcgagcagaataatcaa
cggcgaacgacgtttctctacggcgcgcgcaccgtggctgacctcccaatgctggacgaa
cttcgacaactctcagatgagctggactggttcacttttatccctgcgctgagtcagcct
gacgataccccgtgggacggcgaaaccggtttgatcaccgaggtttaccaccgaaacttc
ccgagtggccacggacatgaggcgtacttgtgtggcccgcctggaatgatcgatgcagca
ctggagtcgctgatcgctagcggctgtaaggagcgccatattttctttgacaggttcgtt
ccgtctggatag

DBGET integrated database retrieval system