KEGG   Macaca mulatta (rhesus monkey): 574205
Entry
574205            CDS       T01028                                 

Gene name
STX1A
Definition
(RefSeq) syntaxin-1A
  KO
K04560  syntaxin 1A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
mcc04721  Synaptic vesicle cycle
mcc04911  Insulin secretion
mcc05016  Huntington disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    574205 (STX1A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    574205 (STX1A)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    574205 (STX1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    574205 (STX1A)
   05022 Pathways of neurodegeneration - multiple diseases
    574205 (STX1A)
  09165 Substance dependence
   05031 Amphetamine addiction
    574205 (STX1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    574205 (STX1A)
Membrane trafficking [BR:mcc04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    574205 (STX1A)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 GNVR Ferritin Laminin_II FlgN Prominin FAD_binding_1 DUF1910 Lzipper-MIP1 LMBR1 Syntaxin-6_N PspA_IM30 Herpes_UL25 DUF148 Lipoprotein_2
Other DBs
NCBI-GeneID: 574205
NCBI-ProteinID: NP_001028037
Ensembl: ENSMMUG00000014555
UniProt: Q9N0X9
Position
3
AA seq 288 aa
MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQPIEQEAGLNRSSADLRIRKTQH
STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASG
IIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASTVGGIFA
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaggaccgaacccaggagctccgcacggccaaggacagcgatgatgatgatgatgtc
actgtcaccgtggaccgagaccgcttcatggatgagttctttgaacaggtggaggagatt
cgaggcttcattgacaagatcgcagagaatgtggaggaggtgaagcggaagcacagtgcc
atcctggcctcccccaaccccgatgagaagacgaaggaggagctggaagaactcatgtcc
gacataaagaagacagcaaacaaagttcgttccaagttaaagagcatcgagcagcccatc
gagcaagaggcaggcctgaaccgctcctctgctgacctgaggatccggaagacacagcat
tccacgctgtccagaaagtttgtggaggtcatgtcggagtacaacgccacgcagtccgac
taccgcgagcgctgcaagggccgtatccagaggcagctggagatcaccggcaggaccacg
accagtgaggagctggaggacatgctggagagtgggaaccccgccatctttgcatctggg
atcatcatggactccagcatctcaaagcaggctctgagcgaaattgagacgcggcacagc
gagatcatcaagctggagaacagcatccgtgagctgcacgacatgttcatggacatggcc
atgcttgtggagagccagggggagatgattgacaggatcgagtacaacgtggaacacgcg
gtagactacgtggagagggccgtgtctgacaccaagaaagccgtcaagtaccagagcaag
gcgcgccggaagaaaatcatgatcatcatctgctgtgtgatcctgggcatcgtcatcgcc
tccactgttgggggcatcttcgcctag

KEGG   Macaca mulatta (rhesus monkey): 698953
Entry
698953            CDS       T01028                                 

Gene name
STX3
Definition
(RefSeq) syntaxin-3 isoform X7
  KO
K08486  syntaxin 1B/2/3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
mcc04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    698953 (STX3)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    698953 (STX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    698953 (STX3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    698953 (STX3)
Membrane trafficking [BR:mcc04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    698953 (STX3)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   698953 (STX3)
  Exosomal proteins of other body fluids (saliva and urine)
   698953 (STX3)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Branch GyrB_insert DUF5984 LPD11 SIMPL
Other DBs
NCBI-GeneID: 698953
NCBI-ProteinID: XP_001089614
Ensembl: ENSMMUG00000022319
UniProt: A0A1D5Q2C9
Position
14
AA seq 277 aa
MKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLY
SIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQH
SVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSG
IIDSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTV
DHVEKARDETKKAVKYQSQARKKLISLQPGVATLVFR
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaggaccggctggagcagctgaaggccaagcagttgacacaggatgatgatactgat
gaggtcgagattgctatcgacaacacggcttttatggacgagttcttttctgagattgag
gaaactcggcttaacattgacaagatctcagaacatgtggaggaggctaagaaactctac
agtatcattctctctgcaccgattccagagccaaaaaccaaggatgacctagagcagctc
acgactgagattaagaaaagggccaacaacgtccggaacaaactgaagagcatggagaag
catattgaagaagatgaggtcaggtcatcggcagaccttcggattcggaaatcccagcac
tctgtcctttctcggaagtttgtggaggtgatgaccaaatacaatgaagctcaggtggac
tttcgagaacgaagcaaagggcgaatccagcggcagctcgaaattactggcaaaaagacc
acagatgaggagctggaggagatgttggagagcggcaacccggccatcttcacttctggg
atcattgactcgcagatttccaagcaagccctcagtgagattgagggacggcacaaggac
attgtgaggctggagagcagcatcaaggagcttcatgacatgtttatggacattgccatg
ctggtggagaatcagggtgagatgttagataacatagagttgaatgtcatgcacacagtg
gaccacgtggagaaggcacgagatgaaacgaaaaaagctgtgaaataccagagtcaggcc
cggaagaaactgatttcactccagcctggtgtggccacccttgtcttcagatga

KEGG   Macaca mulatta (rhesus monkey): 704880
Entry
704880            CDS       T01028                                 

Gene name
STX4
Definition
(RefSeq) syntaxin-4 isoform X1
  KO
K13502  syntaxin 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
mcc04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    704880 (STX4)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    704880 (STX4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    704880 (STX4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    704880 (STX4)
Membrane trafficking [BR:mcc04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    704880 (STX4)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   704880 (STX4)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 DUF3671 GlutR_dimer PilO T2SSF AAA_13 DUF16 Vac_Fusion Lectin_N Nmad5 ERp29 DUF848
Other DBs
NCBI-GeneID: 704880
NCBI-ProteinID: XP_014981498
Ensembl: ENSMMUG00000048207
UniProt: G7NQX9 A0A1D5QEP4
Position
20
AA seq 297 aa
MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFQKVRTIRQTIVKLGNKVQ
ELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSINT
RMRKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSG
QSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHDIFTFLASEVEMQGEMINR
IEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG
NT seq 894 nt   +upstreamnt  +downstreamnt
atgcgggacaggacccacgagctgaggcagggggatgacagctcggacgaagaggacaag
gagcgagtcgcgctggtggtgcacccaggcacggcacggctggggagcccggacgaggag
ttcttccagaaggtccggacaattcggcagactattgtcaagctggggaataaagtccag
gagttggagaaacagcaggtcaccatcctggccacgccccttcctgaggagagcatgaag
caggagctgcagaacctgcgcgacgagatcaaacagctggggagggagatccgcctgcag
ctgaaggccatagagccccagaaggaggaagctgatgagaactataactccatcaacaca
agaatgagaaaaacccagcatggggtcctgtcccagcaattcgtggagctcatcaacaag
tgcaattcaatgcagtccgaataccgggagaagaacgtggagcggatccggaggcagctg
aagatcaccaatgctgggatggtgtctgacgaggagctggagcagatgctggatagtggg
cagagcgaggtgtttgtgtccaatatcctgaaggacacacaggtgactcgacaggcctta
aatgagatctcggcccggcacagtgagatccagcagcttgaacgcagtattcgtgagctg
cacgatatcttcacttttctggcttctgaagtggagatgcagggggagatgatcaatcgg
attgagaagaacatcctgagctcagcggactacgtggaacgcgggcaggagcacgtcaag
acagccctggagaaccagaagaaggcgaggaagaagaaagtcttgattgccatctgtgtg
tccatcaccgtcgtcctcctagcagtcatcattggcgtcacagtggttggataa

KEGG   Macaca mulatta (rhesus monkey): 714251
Entry
714251            CDS       T01028                                 

Gene name
STX1B
Definition
(RefSeq) syntaxin-1B isoform X1
  KO
K08486  syntaxin 1B/2/3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
mcc04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    714251 (STX1B)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    714251 (STX1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    714251 (STX1B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    714251 (STX1B)
Membrane trafficking [BR:mcc04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    714251 (STX1B)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   714251 (STX1B)
  Exosomal proteins of other body fluids (saliva and urine)
   714251 (STX1B)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 Lzipper-MIP1 GNVR FAD_binding_1 Baculo_PEP_C Acyl-CoA_dh_2 TolA_bind_tri Sec34
Other DBs
NCBI-GeneID: 714251
NCBI-ProteinID: XP_014981476
Ensembl: ENSMMUG00000003236
UniProt: H9EME4
Position
20
AA seq 288 aa
MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAI
LAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHS
TLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDI
KMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSV
DYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaggatcggactcaggagctgcggagtgcgaaagacagtgatgatgaagaggaggtg
gtccacgtggatcgggaccacttcatggatgagttctttgaacaggtggaagagatccgg
ggctgcattgagaaactgtcggaggatgtggagcaggtgaaaaaacagcatagcgccatc
ctggctgcccccaacccagatgagaagaccaaacaggagctggaggacctcactgcagac
atcaagaagacggccaacaaggttcggtccaaattgaaagcgatcgagcaaagcattgaa
caggaggaggggctcaaccgttcctccgcggacctgcgcatccgcaagacccagcactcc
acactgtcccggaagttcgtggaggtaatgaccgaatataacgcgacccagtccaagtac
cgggaccgctgcaaggaccggatccagcggcaactggagatcactggaaggaccaccacc
aacgaagaactggaagacatgctggagagcgggaagctggctatcttcacagatgacatc
aaaatggactcacagatgacgaagcaggcgctgaatgagatcgagacaaggcacaatgag
atcatcaagctggagaccagcatccgtgagctgcacgacatgtttgtggacatggccatg
cttgtagagagccagggagagatgattgaccgcatcgagtacaatgtggaacattctgta
gactacgtggagcgagctgtgtctgacaccaagaaagcagtgaaatatcagagcaaggcc
cggaggaagaaaatcatgatcatcatttgctgtgtggtgctgggggtggtcttggcgtca
tccattggggggacgctgggcttgtag

KEGG   Macaca mulatta (rhesus monkey): 718628
Entry
718628            CDS       T01028                                 

Gene name
STX2
Definition
(RefSeq) syntaxin-2 isoform X1
  KO
K08486  syntaxin 1B/2/3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
mcc04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    718628 (STX2)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    718628 (STX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    718628 (STX2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    718628 (STX2)
Membrane trafficking [BR:mcc04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    718628 (STX2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   718628 (STX2)
  Exosomal proteins of other body fluids (saliva and urine)
   718628 (STX2)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Branch Tlp Syntaxin-6_N DUF16 ApoLp-III YnfE DUF848 YtxH DLP_helical DUF2205 CbiA ISG65-75
Other DBs
NCBI-GeneID: 718628
NCBI-ProteinID: XP_014965197
Ensembl: ENSMMUG00000020926
Position
11
AA seq 293 aa
MRDRLPDLTACRKNDDGDTVVVVEKDHFMEDFFHQVEEIRNSIDKITQYVEEVKKNHSII
LSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS
VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFISDI
ISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNIMNAT
DYVEHAKEETKKAIKYQSKARRQQHCHSNHIPRAIYPWRLRPHLQPDQHPVIS
NT seq 882 nt   +upstreamnt  +downstreamnt
atgcgggaccggctgccagacctgaccgcgtgtaggaagaatgatgatggagacacagtt
gttgtggttgagaaagaccatttcatggaggatttcttccatcaggttgaggagattaga
aacagtattgataaaataactcaatatgttgaagaagtaaagaaaaaccacagcatcatt
ctttctgcaccaaacccagaaggaaaaataaaagaagagcttgaagatctgaacaaagaa
atcaagaaaactgcaaataaaattcgagccaagttaaaggctattgaacaaagttttgat
caggatgagagtgggaaccggacttcagtggatcttcggatacgaagaacccagcattcg
gtgctgtctcggaagtttgtggaagccatggcggagtacaatgaggcacagactctgttt
cgggagcggagcaagggccgcatccagcgccagctggagataactgggagaaccaccaca
gacgacgagctggaagagatgctggagagcgggaagccgtccatcttcatttccgacatt
atatcagattcacaaattactagacaagctctcaatgaaatcgagtcacgtcacaaggac
atcatgaagctggagaccagcatcagagagttgcatgagatgttcatggacatggctatg
tttgtggagactcagggtgaaatgatcaacaacatagaaagaaacattatgaatgccaca
gactatgtagaacacgctaaagaagaaacaaaaaaagctatcaaatatcagagcaaggcg
agaaggcaacaacattgtcatagcaaccatatcccaagagccatttatccttggagactc
agaccacatctgcaaccagatcagcatcctgtcatttcgtga

DBGET integrated database retrieval system