KEGG   Macaca mulatta (rhesus monkey): 574268
Entry
574268            CDS       T01028                                 

Gene name
GOSR1
Definition
(RefSeq) Golgi SNAP receptor complex member 1
  KO
K08495  golgi SNAP receptor complex member 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    574268 (GOSR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    574268 (GOSR1)
Membrane trafficking [BR:mcc04131]
 SNARE
  SNAP-25[N] (Qb)
   Gos1 (Gos28)
    574268 (GOSR1)
SSDB
Motif
Pfam: V-SNARE_C Sec20 DUF1664
Other DBs
NCBI-GeneID: 574268
NCBI-ProteinID: NP_001244874
Ensembl: ENSMMUG00000023698
UniProt: A0A5K1TXI0
Position
16
AA seq 248 aa
MAAGTSNYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDSSDTTPLLNGSS
QDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEF
HKTKANFMAIRERENLMGSVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETIS
IAMATKENMTSQRGMLKSIHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTI
LLLLYAFH
NT seq 747 nt   +upstreamnt  +downstreamnt
atggcggcaggaaccagcaattactgggaagatctcaggaaacaggctcgacagctggaa
aatgaacttgacctgaaactagtttccttcagcaaactatgtacaagttacagtcatagc
agtacccgagatggaagacgcgacagttctgatacaacacctcttttaaatggatcaagc
caagacagaatgtttgagacaatggcgatcgagattgaacaacttttggcaaggcttaca
ggggtaaacgataaaatggcagaatataccaacagtgcaggtgtcccctccttgaatgcg
gccctgatgcatacattacagcggcatagagacatattgcaggattatacacatgaattc
cataaaaccaaagcaaactttatggcaatacgggaaagggagaatctcatgggatcagta
cgaaaagatattgaatcatataaaagtgggtctggagtaaacaacagaagaactgagcta
tttttgaaagaacatgaccaccttcgaaactcagatcgtctgatagaagagacaataagc
attgctatggcaacaaaagaaaatatgacttcacagagaggaatgttgaagtcaattcac
agcaaaatgaacactttggccaatcgttttcctgctgtaaacagcctgatccagaggatc
aacctgaggaagcggcgggactcgctcatcctagggggtgttattgggatctgtaccatc
ctgttgctgctgtatgcgttccattga

DBGET integrated database retrieval system