KEGG   Macaca mulatta (rhesus monkey): 678670
Entry
678670            CDS       T01028                                 

Gene name
CYP3A4
Definition
(RefSeq) cytochrome P450 3A64
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00140  Steroid hormone biosynthesis
mcc00591  Linoleic acid metabolism
mcc00830  Retinol metabolism
mcc00980  Metabolism of xenobiotics by cytochrome P450
mcc00982  Drug metabolism - cytochrome P450
mcc00983  Drug metabolism - other enzymes
mcc01100  Metabolic pathways
mcc04976  Bile secretion
mcc05204  Chemical carcinogenesis - DNA adducts
mcc05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    678670 (CYP3A4)
   00591 Linoleic acid metabolism
    678670 (CYP3A4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    678670 (CYP3A4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    678670 (CYP3A4)
   00982 Drug metabolism - cytochrome P450
    678670 (CYP3A4)
   00983 Drug metabolism - other enzymes
    678670 (CYP3A4)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    678670 (CYP3A4)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    678670 (CYP3A4)
   05207 Chemical carcinogenesis - receptor activation
    678670 (CYP3A4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mcc00199]
    678670 (CYP3A4)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     678670 (CYP3A4)
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     678670 (CYP3A4)
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     678670 (CYP3A4)
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     678670 (CYP3A4)
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     678670 (CYP3A4)
    1.14.14.-  
     678670 (CYP3A4)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP3 family
   678670 (CYP3A4)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 678670
NCBI-ProteinID: NP_001035504
Ensembl: ENSMMUG00000043107
UniProt: Q6PSM4
Position
3
AA seq 503 aa
MDLIPDLAVETWLLLAVTLVLLYLYGTHSHGLFKKLGIPGPTPLPLLGNILSYRKGFWTF
DMECYKKYGKVWGFYDGRQPVLAITDPNMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAKYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITIFPFIIPILEVLNISI
FPREVTSFLRKSVKRIKESRLKDTQKHRVDFLQLMIDSQNSKETESHKALSDQELVAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKLQEEIDTVLPNKAPPTYDTVLQMEYLDMVV
NETLRIFPIAMRLERVCKKDVEINGIFIPKGVVVMIPSYALHHDPKYWPEPEKFLPERFS
KKNNDNIDPYIYTPFGSGPRNCIGMRFALMNMKLAIIRVLQNFSFKPCKETQIPLKLRLG
GLLQTEKPIVLKIESRDGTVSGA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggatctcatcccagacttggctgtggaaacctggcttctcttggctgtcaccctggtg
ctcctctatttatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctttgcctttattgggaaacattttgtcctaccgtaagggcttttggacgttt
gatatggaatgttataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcccaacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaaatgccatctctata
gctgaggatgaagaatggaagagaatacggtcattgctctctccaaccttcaccagcgga
aaactcaaggagatggtccctatcattgccaagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaagatgtctttggggcctacagc
atggacgtgatcactagcacatcatttggagtgaatatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgatttcttagatccattcttt
ctctcaataacaatcttcccatttatcatcccaattcttgaagtattaaatatctctatt
tttccaagagaagttacaagttttttaagaaaatctgtaaaaaggataaaagaaagtcgc
ctcaaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagaaactgagtcccacaaagctctgtctgatcaggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcattatatatgag
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatctcgacatggtggtg
aatgaaacgctcagaatattcccaattgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatattcatacccaaaggggtggtggtgatgattccaagctatgct
cttcatcatgacccaaagtactggccagagcctgagaagttcctccctgaaaggttcagc
aagaagaacaatgacaacatagatccttacatatacacgccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctataatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatcccactgaaattacgcttagga
ggacttcttcaaacagaaaaacccattgttctaaagattgagtcaagggatgggaccgta
agtggagcctga

DBGET integrated database retrieval system