KEGG   Macaca mulatta (rhesus monkey): 696708
Entry
696708            CDS       T01028                                 

Gene name
SNAP29
Definition
(RefSeq) synaptosomal-associated protein 29
  KO
K08509  synaptosomal-associated protein 29
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
mcc04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    696708 (SNAP29)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    696708 (SNAP29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    696708 (SNAP29)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    696708 (SNAP29)
 SNARE
  SNAP-25 (Qb,c)
   SNAP-29
    696708 (SNAP29)
SSDB
Motif
Pfam: V-SNARE_C KxDL
Other DBs
NCBI-GeneID: 696708
NCBI-ProteinID: NP_001248290
Ensembl: ENSMMUG00000020384
UniProt: G7N3B5 H9G1X8
Position
10
AA seq 258 aa
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDEPDAPADRQQYLRQEVLRRAEATAAST
SRSLALMYESEKVGVASSEELVRQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLV
NYFKSKPAEAPPEQNGTLASQPNSRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGA
GSAVSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTK
VDKLDVNIKSTERKVRQL
NT seq 777 nt   +upstreamnt  +downstreamnt
atgtcagcttaccctaaaagctacaatcccttcgacgacgacggggaggacgaaggcgcc
cggccggccccttggagggacgcccgggacctccccgacgagcccgacgcgccagcggac
aggcagcagtacttgcggcaggaggtgctccgcagggctgaggccacggccgccagcacc
agcaggtccctggccctcatgtacgagtccgagaaggttggggtcgcctcttccgaggag
cttgtccgtcagcgaggagtcctggagcgcacagagaagatggtggacaagatggaccaa
gatttgaagatcagccagaaacacatcaatagcattaagagcgtgtttggggggctcgtc
aattacttcaaatccaaaccagcagaggccccacctgaacagaatggcaccctcgcctcc
cagcccaacagcagattgaaagaagccataagtacaagtaaagaacaggaagcaaagtac
caggccagccacccaaaccttagaaagctggatgatacagaccctgtccccagaggggct
ggttctgctgtgagtaccgatgcttacccaaagaacccacaccttcgagcctatcaccag
aagatcgacagcaacctagatgagctctccatgggactgggccgtctgaaggacatagcc
ctggggatgcagacggaaattgaggagcaagatgacattcttgaccggctgacaaccaaa
gtggacaagttagatgtcaacataaaaagcacagaaagaaaagttcgacaactctga

DBGET integrated database retrieval system