KEGG   Macaca mulatta (rhesus monkey): 699606
Entry
699606            CDS       T01028                                 

Gene name
YKT6
Definition
(RefSeq) synaptobrevin homolog YKT6
  KO
K08516  synaptobrevin homolog YKT6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    699606 (YKT6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    699606 (YKT6)
Membrane trafficking [BR:mcc04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Ykt6
    699606 (YKT6)
SSDB
Motif
Pfam: Longin Synaptobrevin
Other DBs
NCBI-GeneID: 699606
NCBI-ProteinID: NP_001253469
Ensembl: ENSMMUG00000002430
UniProt: F6PLE2 G7MLE0
Position
3
AA seq 198 aa
MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASVK
EQDYLCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHY
PALDGHLSRYQNPREADPMTKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQ
SKAFYKTARKQNSCCAIM
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaaactgtacagcctcagcgtcctctacaaaggcgaggccaaggtggtgctgctcaaa
gccgcgtacgatgtgtcttccttcagctttttccagagatccagcgttcaggaattcatg
accttcacgagtcaactgattgtggagcgttcatcgaaaggcactagagcttctgtcaaa
gaacaagactatctgtgccatgtctacgtccggaatgatagtcttgcaggtgtggtcatt
gccgacaatgaatacccatcccgggtggcctttaccttgctggagaaggtactagatgaa
ttctccaagcaagttgacaggatagactggccagtaggatcccctgctacaatccattac
ccagccctggatggtcacctcagtagataccagaacccacgagaagctgatcccatgact
aaagtgcaggccgaactagatgagaccaaaatcattctgcacaacaccatggagtctctg
ttagagcgaggtgagaagctagatgacttggtgtccaaatccgaggtgctgggaacgcag
tctaaagccttctataaaactgcccggaaacaaaactcatgctgtgccatcatgtga

KEGG   Macaca mulatta (rhesus monkey): 704501
Entry
704501            CDS       T01028                                 

Definition
(RefSeq) synaptobrevin homolog YKT6-like
  KO
K08516  synaptobrevin homolog YKT6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    704501
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    704501
Membrane trafficking [BR:mcc04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Ykt6
    704501
SSDB
Motif
Pfam: Longin Synaptobrevin
Other DBs
NCBI-GeneID: 704501
NCBI-ProteinID: XP_001092856
Position
4
AA seq 271 aa
MKLYSLSVLYKGGAKVVLLKVGYDDVASFSFSQRSSVQEFMTFTSQLIMERSSKGTRASV
AEQDYLWHVYVQNDSLAGVIITDNECPSLVAFTLLEKVLDEFSKQVNRKDWPVGSPATIH
SASLDGHLSRYQNPRDADPMTKVQAEPDETQIILHNTMDSLLERGEKLGGLVSKSEVLGT
GAFYKTARKQNSCCAMAQHWNSTIIRIRTAAPREEETVLHEDLEWGHTGHFYFEVPRRSR
DGGRVENVQINMCGSDSWKEFEVHEGGFLGK
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaagctgtacagcctcagtgtcctctacaaaggcggggccaaggtagtactgctcaaa
gtcgggtacgacgatgtggcttccttcagcttttctcagagatccagcgttcaggaattc
atgaccttcacaagtcaactgattatggagcgctcatctaaaggcactagagcttctgtc
gcagaacaagactatctgtggcacgtctatgttcagaatgacagtcttgcaggtgtcatc
attactgacaatgagtgcccatccctggtggcctttaccttgctggagaaagtactagat
gaattctccaagcaagtcaacaggaaagactggccagtaggatcccctgctacaatccat
tctgcatccctggatggtcacctcagtagataccagaacccacgagacgctgaccccatg
actaaagtgcaggccgaaccagacgagacccagatcattctgcacaataccatggattct
ttgttagagcgaggtgagaagctaggtggcttggtgtccaaatccgaggtgctaggaaca
ggtgccttctataaaactgcccggaaacaaaactcgtgttgtgcaatggcccagcactgg
aacagcaccatcattcgcatcagaactgcagcccccagagaagaagagacagtcctacac
gaggacctggagtgggggcacacgggccatttttattttgaagttcccaggagaagcagg
gatggtggaagggtggagaatgttcaaattaatatgtgtggtagtgattcttggaaagaa
tttgaggtccatgaaggtggatttttgggcaaatga

DBGET integrated database retrieval system