KEGG   Macaca mulatta (rhesus monkey): 708225
Entry
708225            CDS       T01028                                 

Gene name
SNAP23
Definition
(RefSeq) synaptosomal-associated protein 23
  KO
K08508  synaptosomal-associated protein 23
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
mcc04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    708225 (SNAP23)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    708225 (SNAP23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    708225 (SNAP23)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    708225 (SNAP23)
Membrane trafficking [BR:mcc04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-23
    708225 (SNAP23)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   708225 (SNAP23)
  Exosomal proteins of other body fluids (saliva and urine)
   708225 (SNAP23)
  Exosomal proteins of colorectal cancer cells
   708225 (SNAP23)
SSDB
Motif
Pfam: SNAP-25 DUF5089 V-SNARE_C Sec20 SOAR DUF1664
Other DBs
NCBI-GeneID: 708225
NCBI-ProteinID: NP_001248267
Ensembl: ENSMMUG00000014043
UniProt: A0A1D5QYR9 G7MWZ1
Position
7
AA seq 211 aa
MDNLSSEEIQLRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGLD
QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPG
PVTNGQPQQPMTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQ
NPQIKRITDKADTNKDRIDIANARAKKLIDS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggataatctgtcatcagaagaaattcaactgagagctcaccagattactgatgagtct
ctggaaagtacgaggagaatcctgggtttagccattgagtctcaggatgcaggaatcaag
accatcactatgctggatgaacaaggggaacaactaaaccgcatagaagaaggcttggac
caaataaataaagatatgagagagacagagaagaccttaacagaactcaacaaatgctgt
ggcctttgtgtctgcccatgtaatagaacaaagaactttgagtctggcaaggcttataag
acaacatggggagatggtggagaaaactcaccttgcaatgtagtatctaaacagccaggc
ccggtgacaaatggtcagcctcagcaaccaatgacaggagcagccagtggtggatacatt
aaacgcataactaatgatgccagagaagatgaaatggaagagaacctgactcaagtgggt
agtatcctgggaaatctaaaagacatggccctgaacataggcaatgagattgatgctcaa
aatccgcaaataaaacgaatcacagacaaggctgacaccaacaaagatcgtattgatatt
gccaatgccagagcaaagaaactcattgacagctaa

DBGET integrated database retrieval system