KEGG   Macaca mulatta (rhesus monkey): 709667
Entry
709667            CDS       T01028                                 

Gene name
STX7
Definition
(RefSeq) syntaxin-7
  KO
K08488  syntaxin 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
mcc04145  Phagosome
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    709667 (STX7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    709667 (STX7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    709667 (STX7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    709667 (STX7)
Membrane trafficking [BR:mcc04131]
 SNARE
  Syntaxin (Qa)
   Stx-Endo
    709667 (STX7)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   709667 (STX7)
SSDB
Motif
Pfam: Syntaxin_2 SNARE Syntaxin Prominin Cep57_CLD_2 DUF2976 DUF5329 DUF6033 GAS Synaptobrevin
Other DBs
NCBI-GeneID: 709667
NCBI-ProteinID: NP_001244653
Ensembl: ENSMMUG00000004994
UniProt: F7ATP9 G7MQC9
Position
4
AA seq 261 aa
MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTN
QLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTASLTNFQKVQRQAAEREKEFVA
RVRASSRVSGGFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEA
DIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCI
IILILVIGAVIIGLIIWGLNR
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtcttacactccaggagttggtggtgaccccgcccaactggcccagaggatctcttcc
aacatccagaagatcacacaatgttctgtagaaatacaaagaactctgaatcaacttgga
acacctcaagattcacccgaattgaggcaacagctgcaacagaagcagcagtatactaac
cagcttgccaaagaaacagataagtacattaaagagtttggatctctgcccaccaccccc
agtgaacagcgtcaaaggaaaatacagaaggatcgcttagtggcagagttcacagcatca
ctgacaaacttccagaaggttcagaggcaagcggctgagcgagagaaagagtttgttgct
cgagtaagagccagttccagagtgtctggcggttttcctgaggacagctcaaaagaaagg
aatcttgtatcctgggaaagccaaactcaacctcaagtgcaggtgcaggatgaagaaatt
acagaggatgacctccgccttattcatgagagagaatcttctatcaggcaacttgaagct
gatattatggatattaatgaaatatttaaagatttgggaatgatgattcatgaacaagga
gatgtaatagatagcatagaagccaacgtggaaaatgcagaggtgcacgttcagcaagca
aatcagcagctgtcaagggcagcagattatcagcgcaaatccagaaaaaccctgtgcatc
atcattcttatccttgtcattggagctgtgatcattggtctcatcatatggggactgaac
cgctga

DBGET integrated database retrieval system