KEGG   Macaca mulatta (rhesus monkey): 714699
Entry
714699            CDS       T01028                                 

Gene name
STX17
Definition
(RefSeq) syntaxin-17
  KO
K08491  syntaxin 17
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
mcc04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    714699 (STX17)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    714699 (STX17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    714699 (STX17)
Membrane trafficking [BR:mcc04131]
 SNARE
  Syntaxin (Qa)
   Stx-sER
    714699 (STX17)
SSDB
Motif
Pfam: SNARE Phage_holin_3_6 ThrE IncD Gly-zipper_Omp
Other DBs
NCBI-GeneID: 714699
NCBI-ProteinID: NP_001181727
Ensembl: ENSMMUG00000011414
UniProt: F6VSJ7 G7NEX8
Position
15
AA seq 302 aa
MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGR
TVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQF
NDEEILLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLI
ELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKYKLAALPVAGALIG
GMVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRKKQKMMEKLTSSCPDLPSQTDKK
CS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgtctgaagatgaagaaaaagtgaaattacgccgtcttgaaccagctatccagaaattc
attaagatagtaatcccaacagacctggaaaggttaagaaagcaccagataaatattgag
aagtatcaaaggtgtagaatctgggacaagttgcatgaagagcatatcaatgcaggacgt
acagttcagcaactccgatccaatatccgagaaattgagaagctttgtttgaaagtccga
aaggatgacctagtacttctgaagagaatgatagatcctgttaaagaagaagcatcagca
gcaacagcagaatttctccaactccatttggaatctgtagaagaacttaagaagcaattt
aatgatgaagaaattttgctacagcctcctttgaccagatccatgactgttggtggagca
tttcatactactgaagctgaagctagttctcagagtttgactcagatatatgccttacct
gaaattcctcaagatcaaaatgctgcagaatcgtgggaaaccttagaagcggacttaatt
gaacttagccaactggtcactgacttctctctcctagtgaactctcagcaggagaagatt
gacagcattgcagaccatgtcaacagtgccgctgtgaatgttgaagagggaaccaaaaac
ttggggaaggctgcaaaatacaagctggcagctctgcctgtggcaggtgcactgatcgga
ggaatggtagggggtcctattggcctccttgcaggcttcaaagtggcaggaattgcagct
gcacttggtggtggggtgttgggcttcacaggtggaaaattgatacaaagaaagaaacag
aaaatgatggagaagctcacttccagctgtccagatcttcccagccaaactgacaagaaa
tgcagttaa

DBGET integrated database retrieval system