KEGG   Macaca mulatta (rhesus monkey): 717678
Entry
717678            CDS       T01028                                 

Gene name
STX8
Definition
(RefSeq) syntaxin-8
  KO
K08501  syntaxin 8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    717678 (STX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    717678 (STX8)
Membrane trafficking [BR:mcc04131]
 SNARE
  SNAP-25[C] (Qc)
   STX8
    717678 (STX8)
SSDB
Motif
Pfam: SNARE Use1 Prominin Otopetrin
Other DBs
NCBI-GeneID: 717678
NCBI-ProteinID: NP_001252683
Ensembl: ENSMMUG00000009398
UniProt: F6XAN6
Position
16
AA seq 236 aa
MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKD
LLLRAVATHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGA
PNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQN
EIIDDLANLVENTDEKLRTETRRVNLVDRKSTSCGMIMVILLLLVAIVVVAVWPTN
NT seq 711 nt   +upstreamnt  +downstreamnt
atggcaccggacccctggttctccacatacgattctacttgtcaaattgcccaagaaatt
gcggagaaaattcaacaacgaaatcagtatgaaagaaaaggtgaaaaggcaccgaagctt
accgtgacaatcagagctttgttgcagaacctgaaggaaaagatcgcccttttgaaggac
ttattgctaagagctgtggcaacacatcagataacacagcttgaaggggaccgaagacag
aacctgttggatgatcttgtaactcgggagagactacttctggcatcctttaagaatgag
ggtgccgaaccagatctaatcaggtccagcctgatgagtgaagaggctaagcgaggagca
cccaacccttggctctttgaggagccagaggagaccagaggcttgggttttgatgaaatc
cggcaacagcagcagaaaattatccaagaacaggacgcaggccttgatgccctttcttcc
atcataagtcgccaaaaacaaatgggacaggaaattgggaatgaattggatgaacaaaat
gagataattgacgaccttgccaacctggtggagaacacagatgaaaaacttcgcactgaa
accaggcgtgtaaacctggtggacagaaagtcaacctcttgtgggatgatcatggtgatt
ttactgctgctcgtggctatcgtggtggttgcggtctggccgactaattga

DBGET integrated database retrieval system