KEGG   Macaca fascicularis (crab-eating macaque): 101864991
Entry
101864991         CDS       T02918                                 

Gene name
CD4
Definition
(RefSeq) CD4 molecule
  KO
K06454  T-cell surface glycoprotein CD4
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf05135  Yersinia infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101864991 (CD4)
   04514 Cell adhesion molecules
    101864991 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101864991 (CD4)
   04612 Antigen processing and presentation
    101864991 (CD4)
   04660 T cell receptor signaling pathway
    101864991 (CD4)
   04658 Th1 and Th2 cell differentiation
    101864991 (CD4)
   04659 Th17 cell differentiation
    101864991 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101864991 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101864991 (CD4)
   05170 Human immunodeficiency virus 1 infection
    101864991 (CD4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101864991 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    101864991 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    101864991 (CD4)
CD molecules [BR:mcf04090]
 Proteins
  101864991 (CD4)
SSDB
Motif
Pfam: CD4-extracel C2-set ig V-set Ig_3 I-set Ig_2 Tcell_CD4_C Receptor_2B4 Ig_6 Herpes_gE Pilin
Other DBs
NCBI-GeneID: 101864991
NCBI-ProteinID: XP_005570013
UniProt: A0A2K5WVH1 G7PJN3
Position
11
AA seq 458 aa
MNRGIPFRHLLLVLQLALLPAVTQGKKVVLGKKGDTVELTCNASQKKNTQFHWKNSNQIK
ILGIQGSFLTKGPSKLSDRADSRKSLWDQGCFSMIIKNLKIEDSDTYICEVENKKEEVEL
LVFGLTANSDTHLLEGQSLTLTLESPPGSSPSVKCRSPGGKNIQGGRTLSVPQLERQDSG
TWTCTVSQDQKTVEFKIDIVVLAFQKASSTVYKKEGEQVEFSFPLAFTLEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQFQENLTCEVWGPTSPKLTLSLKLENKGTTVSKQAKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVVPTWPTPVQPMALIVLGGVAGLLLFTGLGIFFCV
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaaccggggaatcccttttaggcacttgcttctggtgctgcaactggcgctactccca
gcagtcacccagggaaagaaagtggtgctgggcaagaaaggggatacagtggaactgacc
tgtaatgcttcgcagaagaagaacacacaattccactggaaaaactccaaccagataaag
attctgggaattcagggctccttcttaactaaaggtccatccaagctgagcgatcgtgct
gactcaagaaaaagcctttgggaccaaggatgcttttccatgatcatcaagaatcttaag
atagaagactcagatacttacatctgtgaagtggagaacaagaaggaggaggtggaattg
ctggtgttcggattgactgccaactctgacacccacctgcttgaggggcaaagcctgacc
ctgaccttggagagcccccctggtagtagcccctcagtgaaatgtaggagtccagggggt
aaaaacatacagggggggaggaccctctctgtgcctcagctggagcgccaggatagtggc
acctggacatgcaccgtctcgcaggaccagaagacggtggagttcaaaatagacatcgtg
gtgctagctttccagaaggcctccagcacagtctataagaaagagggggaacaggtggag
ttctccttcccactcgcctttacacttgaaaagctgacgggcagtggcgagctgtggtgg
caggcggagagggcctcctcctccaagtcttggattaccttcgacctgaagaacaaggaa
gtgtctgtaaaacgggttacccaggaccccaagctccagatgggcaagaagctcccgctc
cacctcaccctgccccaggccttgcctcagtatgctggctctggaaacctcacgctggcc
cttgaagcgaaaacaggaaagttgcatcaggaagtgaacctcgtggtgatgagagccact
cagttccaggaaaatttgacctgtgaagtgtggggacccacctcccctaagctgacgctg
agcttgaaactggagaacaaggggacaacggtctcgaagcaggcgaaggcggtgtgggtg
ctgaaccctgaggcggggatgtggcagtgtctgctgagtgactcgggacaggtcctgcta
gaatccaacatcaaggttgtgcccacatggcccaccccggtgcagccaatggccctgatt
gtgctggggggcgttgcgggcctcctgcttttcactgggctaggcatcttcttctgtgtc
aggtgccggcatcgaaggcgtcaagcagagcggatgtctcagatcaagagactcctcagt
gaaaagaagacctgccagtgccctcaccggtttcagaagacatgtagccccatttga

DBGET integrated database retrieval system