KEGG   Macaca fascicularis (crab-eating macaque): 101866035
Entry
101866035         CDS       T02918                                 

Gene name
ITGAM
Definition
(RefSeq) integrin subunit alpha M
  KO
K06461  integrin alpha M
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04015  Rap1 signaling pathway
mcf04145  Phagosome
mcf04514  Cell adhesion molecules
mcf04610  Complement and coagulation cascades
mcf04613  Neutrophil extracellular trap formation
mcf04640  Hematopoietic cell lineage
mcf04670  Leukocyte transendothelial migration
mcf04810  Regulation of actin cytoskeleton
mcf05133  Pertussis
mcf05134  Legionellosis
mcf05140  Leishmaniasis
mcf05146  Amoebiasis
mcf05150  Staphylococcus aureus infection
mcf05152  Tuberculosis
mcf05202  Transcriptional misregulation in cancer
mcf05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101866035 (ITGAM)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101866035 (ITGAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101866035 (ITGAM)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101866035 (ITGAM)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101866035 (ITGAM)
   04610 Complement and coagulation cascades
    101866035 (ITGAM)
   04613 Neutrophil extracellular trap formation
    101866035 (ITGAM)
   04670 Leukocyte transendothelial migration
    101866035 (ITGAM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101866035 (ITGAM)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101866035 (ITGAM)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101866035 (ITGAM)
   05134 Legionellosis
    101866035 (ITGAM)
   05150 Staphylococcus aureus infection
    101866035 (ITGAM)
   05152 Tuberculosis
    101866035 (ITGAM)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101866035 (ITGAM)
   05140 Leishmaniasis
    101866035 (ITGAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcf04131]
    101866035 (ITGAM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    101866035 (ITGAM)
   04515 Cell adhesion molecules [BR:mcf04515]
    101866035 (ITGAM)
   04090 CD molecules [BR:mcf04090]
    101866035 (ITGAM)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    101866035 (ITGAM)
Membrane trafficking [BR:mcf04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    101866035 (ITGAM)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101866035 (ITGAM)
Cell adhesion molecules [BR:mcf04515]
 Integrins
  Integrin alpha subunits
   101866035 (ITGAM)
CD molecules [BR:mcf04090]
 Proteins
  101866035 (ITGAM)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   101866035 (ITGAM)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha FG-GAP_3 FG-GAP_2
Other DBs
NCBI-GeneID: 101866035
NCBI-ProteinID: XP_005591796
UniProt: A0A2K5UU26
Position
20
AA seq 1147 aa
MGIQESGYGPPPSSGWQNFFCGLLLSPHVGVFSISTSPHRVVVGAPQEIVAANQTGSLYQ
CDYSIGSCEPIRLQIPEEAVNMSLGLSLAATTSPPQLLACGPTMHQTCSENTYVKGLCFL
FGSNLRQQPQKFPGTLRGCPEQDIAFLIDGSGSINPREFQQMKDFVSVMMEQLKKSKTLF
SLMQYSEEFWTHFTFEEFQRKPNPRSLVNSITQLYGRTHTATAIRKVVRELFNVNQGARK
NARKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSSKSRQELNTIASKP
PRDHVFQVNNFEALKTIQKQLQEKIFAIEGTQTGSASSFEHEMSQEGFSAAITSNGPLLS
TVGSYDWAGGAFLYTSNEKSTFINMTRVDSDMNDAYLGYAATVILRNRVQNLVLGAPRYQ
HIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAPYYYEQTR
GGQVSVCPLPRAQRGRWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAIGAPGEE
DNQGAVYLFHGTSGFGISPSHSQRIAGSKLPSRLQYFGQSLSGGQDLTMDGLVDLTVGAQ
GHVLLVRSQPVLRVEATMEFNPREVARNVFECNDQMVKGKEAGEVRVCLRVQKSTRDRLR
EGQIQSVVTYDLALDSGRPHSRAVFGETKNSTRRQTKTLGLTQTCETLKLQLPDCIEDPV
SPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFIALFPFEKNCGNDNICQDDLSITFSF
MSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVAFFFPLGLSYRKVSRLQNQRSQRSWRLA
CESASSTEVPGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKANVTSENN
MSRTNKTEFQRELPVKYAVYMVVTSHEVSTKYINFTASENTSRVMQHQYQVKNLGQRSLP
ISLVFLVPVRLNQTIIWDRPQVTFSESLSSTCHTEEMLPTPHTDFLAKLRKDPVVNCSIA
VCQRIKCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLVVSTAEIMFNNSTFTLLPGQ
GAFVRAQTETKVELFEVPNPLPLIVGSSLGGLLLLALITAALYKLGFFKRQYKDMMSEGG
PPGAEPQ
NT seq 3444 nt   +upstreamnt  +downstreamnt
atgggaattcaggaatctgggtatgggcccccaccttcctctgggtggcagaacttcttc
tgtggtctccttctctccccacatgtcggagttttctctatttccacttctccccacagg
gtggtggttggagccccccaggagatagtggctgccaaccaaacgggcagcctctaccag
tgtgattacagcataggctcatgcgagcccatccgcctgcagatccccgaggaggctgtg
aacatgtccctgggcctgtccctggcagccaccaccagccccccccagctgctggcctgt
ggccccaccatgcaccagacttgcagtgagaacacgtatgtgaaagggctctgcttcctg
tttggatccaacctacggcagcagccccagaagttcccggggaccctccgagggtgtcct
gaacaggacatcgccttcttgattgacggctctggtagcatcaacccacgtgaatttcag
cagatgaaggattttgtctcggtcatgatggagcaattaaaaaagtccaaaaccttgttc
tctttgatgcagtactccgaagaattctggactcactttaccttcgaagagttccagcgc
aaacctaacccgagatcactggtgaactcaataacgcagctgtatgggcggacacacacg
gccacggccatccgcaaagtggtacgagaactgtttaacgtcaaccagggagcccgaaag
aatgcccgtaagatcctagttgtcatcacagatggagaaaagtttggcgatccattggga
tatgaggacgtgattcctgaggcagacagagagggagtcattcgctacgtcattggggtg
ggagatgccttccgcagttcgaaatcccgccaagagcttaataccatcgcatccaagcca
cctcgtgatcacgtgttccaggtgaataactttgaggctctgaagaccattcagaagcag
cttcaggagaagatctttgcgatcgagggtactcagacaggaagtgccagctcctttgag
catgagatgtctcaggaaggcttcagtgctgccatcacgtctaacggccccttgctgagc
actgtggggagctatgactgggctggtggagcctttctatatacatcaaatgagaaaagc
accttcatcaacatgaccagagtggattcagacatgaatgatgcttacttgggttatgct
gccaccgtcatcttgcggaaccgagtgcaaaacctggttctgggggcacctcgatatcag
cacatcggcctggtggcgatgttcaggcagaacactggcatgtgggagtccaacgccaat
gtcaagggcacgcagatcggcgcctacttcggggcctccctctgctccgtggatgtggac
agcaacggcagcactgaccttgtcctcatcggcgccccctattactatgagcagacccga
gggggccaggtgtctgtgtgccccttgcccagggcgcagaggggtcggtggcagtgtgat
gctgttctctacggggagcagggccaaccctggggccgctttggggcagccctaacagtg
ctgggggacgtgaatggagacaagctgacggatgtggccattggggccccaggagaggag
gacaaccagggtgctgtttacctgtttcatggaacctcaggatttggcatcagcccctct
catagccagcggatagcaggctccaagctcccttccagactccagtattttggtcagtca
ctgagtggggggcaggacctcacaatggatggactggtggacctgactgtaggagcccag
gggcacgtgctgttggtcaggtcccagccagtactgagagtcgaggcaactatggagttc
aatcccagggaagtggcaaggaatgtatttgagtgtaatgatcagatggtgaaaggcaag
gaagctggggaggtcagagtctgcctccgtgtccagaagagcacacgggatcggctaaga
gaagggcagatccagagtgttgtgacttacgacctggctctggactccggccgcccacat
tcccgcgctgtcttcggtgagacaaagaacagcacgcgcaggcagacgaagaccttgggg
ctgacccagacttgtgagaccctgaagctacagttgccggattgcatcgaggacccagtg
agccccattgtgctgcgcctgaacttctctctggtgggaactcccttgtctgctttcggg
aacctccggccggtgctggctgaggatgctcagagactcttcatagccttatttcccttt
gagaagaattgtggcaatgacaacatttgccaggatgacctcagcatcaccttcagtttc
atgagcctggactgcctcgtggtgggtgggccccgggagttcaacgtgacagtgactgtg
agaaatgacggcgaggactcctacaggacacaggtcgccttcttcttcccacttggcctg
tcctaccggaaggtgtccaggctccagaaccagcgctcacagcgatcctggcgcctggcc
tgtgagtctgcctcctccaccgaagtgcctggggccttgaagagcaccagctgtagcata
aaccaccccatcttcccagaaaactcagaggtcacctttaatatcacatttgatgtggac
tctaaggcttcccttggaaacaaactgctcctcaaggccaatgtgaccagtgagaacaac
atgtccagaaccaacaaaaccgaattccaacgggagctgccggtgaaatatgccgtctac
atggtggtcaccagccatgaggtctccactaaatatatcaacttcacggcctcagagaac
accagtcgggtcatgcagcatcaatatcaggtcaaaaacctggggcagaggagcctcccc
atcagcctggtattcttggtgcctgtccggctgaaccagacgatcatatgggaccgcccc
caggtcactttctccgagagcctctcgagtacgtgccacaccgaggaaatgcttcccacc
cctcacaccgactttctggctaagcttcggaaggacccagtggtgaactgctccatcgct
gtctgccagagaatcaagtgtgacatcccgttctttggcatccaggaagaattcaatgcc
accctcaaaggcaacctctcgtttgactggtacatcaagacctcgcataaccacctcctg
gtcgtgagcacagctgagatcatgtttaacaattccacgttcaccctgcttccgggacag
ggggcgtttgtgagggcccagacagagaccaaagtggagctgttcgaggtccccaacccc
ttgccgctcatcgtgggcagctctctgggggggctgctgctcttggccctcatcaccgcc
gcgctgtacaagctcggcttcttcaagcggcagtacaaggacatgatgagtgaagggggt
cccccgggggccgaaccccagtag

DBGET integrated database retrieval system