KEGG   Macaca fascicularis (crab-eating macaque): 101866748
Entry
101866748         CDS       T02918                                 

Gene name
CD9
Definition
(RefSeq) CD9 molecule
  KO
K06460  CD9 antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101866748 (CD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    101866748 (CD9)
   04090 CD molecules [BR:mcf04090]
    101866748 (CD9)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   101866748 (CD9)
CD molecules [BR:mcf04090]
 Proteins
  101866748 (CD9)
SSDB
Motif
Pfam: Tetraspanin CD20 IBV_3C
Other DBs
NCBI-GeneID: 101866748
NCBI-ProteinID: XP_005569946
UniProt: A0A2K5WGW2
Position
11
AA seq 228 aa
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV
YILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKE
VQEFYKDTYNKLKTKDEPQRETLKAIHYALDCCGLAGGVEQFISDICPKKDVLETLTIKS
CPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
NT seq 687 nt   +upstreamnt  +downstreamnt
atgccggtcaaaggaggcaccaagtgcatcaaatacctgctgttcggatttaacttcatc
ttctggcttgccgggattgctgtccttgccattggactatggctgcgattcgactctcag
accaagagcatcttcgagcaagaaactaataataataattccagcttctacacaggagtc
tacattctgatcggagccggcgccctcatgatgctggtgggcttcctgggctgctgtggg
gctgtgcaggagtcccagtgcatgctgggactgttctttggcttcctcctggtgatattc
gccattgaaatagctgcggccatctggggatattcccacaaggatgaggtgattaaggaa
gttcaggagttttacaaggacacctacaacaagctgaaaaccaaggatgagccccagcgg
gaaacgctgaaagccatccactatgcgttggactgctgtggtttggctgggggcgtggaa
cagtttatctcagacatctgccccaagaaggatgtcctcgaaaccttgaccataaagtcc
tgtcctgatgccatcaaagaggtcttcgacaataaattccacatcatcggcgcagtgggc
atcggcattgccgtggtcatgatatttggcatgatcttcagtatgatcctgtgctgtgct
atccgcaggaaccgcgagatggtctag

DBGET integrated database retrieval system