KEGG   Macaca fascicularis (crab-eating macaque): 101866926
Entry
101866926         CDS       T02918                                 

Gene name
CD34
Definition
(RefSeq) CD34 molecule
  KO
K06474  CD34 antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04514  Cell adhesion molecules
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101866926 (CD34)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101866926 (CD34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    101866926 (CD34)
CD molecules [BR:mcf04090]
 Proteins
  101866926 (CD34)
SSDB
Motif
Pfam: CD34_antigen PAP1
Other DBs
NCBI-GeneID: 101866926
NCBI-ProteinID: XP_005540755
Position
1
AA seq 391 aa
MLVRRGARAGPGMPRGWTALCLLSLLPSGFTSANNTSTVTPKSSTQGTFSTVSTNVSYQE
TAIPSTLGSTSPHPVSQHGNEATTNITETTVKFTSTSGITSVYGTTNSSVQSQTSVITTV
FTTPANISTPETTLKSSLSPGNVSDLSTTSTSLATSPTDPYTSSPPIPSVIKFFVLIQTE
IKCSGIKEVKLTQGICLEQNETSSCAEFRKDRGEDLARVLCGEEQADADAGAQICSLLLA
QSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLRKLGILGFTEQDVASHQSYSRKTLIAL
VTSGTLLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKAS
VNRGAQENGTGQATSRNGHSARQHVVADTEL
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgctggtccgcaggggagcgcgtgcggggcccgggatgccgcggggctggaccgcgctt
tgcttgctgagtttgctgccctctgggttcacaagtgccaacaacaccagtactgttacc
ccaaagtcatctacccagggaacattttcaactgtttctacaaatgtatcgtaccaagaa
actgcaatacctagtacccttggaagtaccagcccacaccctgtgtctcaacatggcaat
gaggccacaacaaacatcacagaaactacagtcaaattcacatctacctctgggatcacc
tcagtttatggaaccacaaactcttctgtccagtcacagacctccgtaatcaccacagtg
ttcaccaccccagccaacatttcaactccagagacaaccttaaagtctagcctgtctcct
ggaaatgtttcagacctttcaaccactagcactagccttgcaacatctcccactgaccca
tatacatcgtctcctcctatcccaagtgtcatcaagttttttgttttaatacagacagaa
atcaaatgttcaggcatcaaagaagtgaaattgactcagggcatctgcctggagcaaaat
gagacctccagctgtgcggagtttaggaaggacaggggagaagacctggcccgagtgctg
tgtggggaggagcaggctgatgctgatgctggggcccagatatgctccctgctccttgcc
cagtctgaggtgaggcctcagtgccttctgctggtcttggccaacagaacagaaatttcc
agcaaactccaacttatgaaaaagcaccagtctgacctgagaaagctggggatcctaggt
ttcactgagcaagatgttgcaagccaccagagctattcccgaaagaccctgattgcgctg
gtcacctcgggaaccctgctggctgtcttgggcatcactggctatttcctgatgaatcgc
cgcagctggagccccacaggagaaaggctgggcgaagacccttattacacggagaacggt
ggaggccagggctatagctcaggacctgggacctcccctgaggctcagggaaaggccagt
gtgaaccgaggggctcaggaaaacgggaccggccaggccacctccagaaacggccattca
gcaagacaacacgtggtggctgataccgaattgtga

DBGET integrated database retrieval system