KEGG   Macaca fascicularis (crab-eating macaque): 101867055
Entry
101867055         CDS       T02918                                 

Gene name
CD24
Definition
(RefSeq) CD24 molecule
  KO
K06469  CD24 antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101867055 (CD24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    101867055 (CD24)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    101867055 (CD24)
CD molecules [BR:mcf04090]
 Proteins
  101867055 (CD24)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  101867055 (CD24)
SSDB
Motif
Pfam: CD24 DUF1180
Other DBs
NCBI-GeneID: 101867055
NCBI-ProteinID: XP_005552293
UniProt: A0A2K5U4D1
Position
4
AA seq 78 aa
MGRAMVARLGLGLLLLALLLPTQIYSSVTTSAPLSSNSSQNTSTTPNPANTTTKAVGGAL
QSTASLFVVSLSLLHLYC
NT seq 237 nt   +upstreamnt  +downstreamnt
atgggcagagcaatggtggccagactcgggctggggctgctgctgctggcactgctccta
cccacgcagatttattcctctgtaacgacttctgcaccactttcaagtaactcctcccag
aatacttcgactaccccaaatccagctaataccaccaccaaggcggttggtggtgccctg
cagtcaacagccagtctcttcgtggtctcactctctcttctacatctctactgttaa

DBGET integrated database retrieval system