KEGG   Macaca fascicularis (crab-eating macaque): 101867071
Entry
101867071         CDS       T02918                                 

Gene name
CD59, MAC-IP, MACIF, Protectin, QmoA-10351, QnpA-17056
Definition
(RefSeq) CD59 molecule
  KO
K04008  CD59 antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04610  Complement and coagulation cascades
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101867071 (CD59)
   04610 Complement and coagulation cascades
    101867071 (CD59)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    101867071 (CD59)
   04090 CD molecules [BR:mcf04090]
    101867071 (CD59)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    101867071 (CD59)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101867071 (CD59)
  Exosomal proteins of other body fluids (saliva and urine)
   101867071 (CD59)
  Exosomal proteins of colorectal cancer cells
   101867071 (CD59)
CD molecules [BR:mcf04090]
 Proteins
  101867071 (CD59)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  101867071 (CD59)
SSDB
Motif
Pfam: UPAR_LY6
Other DBs
NCBI-GeneID: 101867071
NCBI-ProteinID: NP_001270456
UniProt: I7G3X0 G7PQF7
Position
14
AA seq 128 aa
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTTDCKTAINCSSGFDTCLIARAGLQV
YNQCWKFANCNYNDISTLLKESELRYFCCKKDLCNFNEQLENGGTSLSEKTVVLLVTPLL
AAAWCLHP
NT seq 387 nt   +upstreamnt  +downstreamnt
atgggaatccaaggagggtctgtcctgttcgggctgctgcttgtcctggctgtcttctgc
cattcaggtcatagcctgcagtgctacaactgtcctaacccaactactgactgcaaaaca
gccatcaattgttcatctggttttgatacgtgtctcattgccagagctgggttacaagta
tataaccagtgttggaagtttgcgaattgcaattacaatgacatttcaaccctcttgaag
gaaagcgagctacggtacttctgctgcaagaaggacctgtgtaactttaacgaacagctt
gaaaatggtgggacatccttatcagagaaaacagttgttctgctggtgaccccacttctg
gcagcagcctggtgccttcatccctaa

DBGET integrated database retrieval system