KEGG   Macaca fascicularis (crab-eating macaque): 101867173
Entry
101867173         CDS       T02918                                 

Gene name
B2M
Definition
(RefSeq) beta-2-microglobulin
  KO
K08055  beta-2-microglobulin
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04612  Antigen processing and presentation
mcf05163  Human cytomegalovirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101867173 (B2M)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101867173 (B2M)
   05170 Human immunodeficiency virus 1 infection
    101867173 (B2M)
   05168 Herpes simplex virus 1 infection
    101867173 (B2M)
   05163 Human cytomegalovirus infection
    101867173 (B2M)
   05169 Epstein-Barr virus infection
    101867173 (B2M)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    101867173 (B2M)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101867173 (B2M)
SSDB
Motif
Pfam: C1-set Ig_3 I-set
Other DBs
NCBI-GeneID: 101867173
NCBI-ProteinID: NP_001271618
UniProt: I7GKX8
Position
7
AA seq 119 aa
MSPSVALAVLALLSPSGLEAIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLL
KNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
NT seq 360 nt   +upstreamnt  +downstreamnt
atgtctccctcagtggccttagccgtgctggcgctactctctccttctggcctggaggct
atccagcgtactccaaagattcaggtttactcacgccatccaccagagaatggaaagcca
aatttcctgaattgctatgtgtctggatttcatccatctgatattgaagttgacttactg
aagaatggagagaaaatgggaaaagtggagcattcagacttgtctttcagcaaagactgg
tctttctatctcttgtactacactgaattcacccccaatgaaaaagatgagtatgcctgc
cgtgtgaaccatgtgactttgtcagggcccaggacagttaagtgggatcgagacatgtaa

DBGET integrated database retrieval system