KEGG   Macaca fascicularis (crab-eating macaque): 101867504
Entry
101867504         CDS       T02918                                 

Gene name
CD44
Definition
(RefSeq) CD44 molecule (Indian blood group)
  KO
K06256  CD44 antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04512  ECM-receptor interaction
mcf04640  Hematopoietic cell lineage
mcf05169  Epstein-Barr virus infection
mcf05205  Proteoglycans in cancer
mcf05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101867504 (CD44)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101867504 (CD44)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101867504 (CD44)
   05205 Proteoglycans in cancer
    101867504 (CD44)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101867504 (CD44)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    101867504 (CD44)
   04090 CD molecules [BR:mcf04090]
    101867504 (CD44)
   00535 Proteoglycans [BR:mcf00535]
    101867504 (CD44)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    101867504 (CD44)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101867504 (CD44)
  Exosomal proteins of other body fluids (saliva and urine)
   101867504 (CD44)
  Exosomal proteins of colorectal cancer cells
   101867504 (CD44)
  Exosomal proteins of bladder cancer cells
   101867504 (CD44)
CD molecules [BR:mcf04090]
 Proteins
  101867504 (CD44)
Proteoglycans [BR:mcf00535]
 Cell surface proteoglycans
  Others
   101867504 (CD44)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Hyaluronan
  Cell surface receptors
   101867504 (CD44)
SSDB
Motif
Pfam: Xlink CFSR
Other DBs
NCBI-GeneID: 101867504
NCBI-ProteinID: XP_005578248
Position
14
AA seq 742 aa
MDKFRWHAAWGLCLLQLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSVGFETCRYGFIEGHVVIPRIQPNSICAANHTGVYILTSNTSQYDTYCFN
ASAPPKEDCTSVTDLPNAFDGPITITIVNPDGTRYIKKGEYRTNPEDIYPSNPTDDDVSS
GSSSERSSTSGGYIFHTFSTAHPIPDEDGPWITDSTDRIPATTLMSTSATATETATKRQE
TQDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD
EDFISSTISTTPRVFDHTKQNKDWTQWNPSHSNPEVLLQTTARITADVDRNGTTAHEGNW
NPEAHPPLIHHEHHEEEETPYSTSTIQAIPSSTTEETATQKEQWFGNRWHEGYLQTPRED
SHSTTGTAASALTSHPMQGRTTPSPEDSSWTDFFDPISHPMGRGHQAGRRMDMDSSHSTT
LQPTADPNTGLVEDLDRTGPLSMTTKQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV
TGGRRDPNHSEGSTTLLEGYTSHYPDTKESRTFIPVTSAKTGSFGVTEVTVGDSNSNVNH
SLSGDQDAFYPSGGSHTTHGSESAGHSHGSQEGGANTTSGPVRTPQIPEWLIILASLLAL
ALILAVCIAVNSRRRCGQKKKLVINSGNGAVDDRKPSGLNGEASKSQEMVHLVNKEPSET
PDQFMTADETRNLQNVDMKIGV
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggacaagtttcggtggcacgcagcctggggactctgcctcttgcagctgagcctggcg
cagatcgatttgaatataacctgccgctttgcgggtgtattccacgtggagaaaaatggt
cgctacagcatctctcggacggaggctgctgacctctgcaaggctttcaatagcaccttg
cccacaatggcccagatggagaaagctctgagcgtcggatttgagacctgcaggtacggg
ttcatagaagggcacgtggtgattccccggattcagcccaactccatctgtgcagcaaac
cacacaggggtgtacatcctcacgtccaacacctcccagtatgacacatactgcttcaat
gcttcagctccacctaaagaagattgtacatcagtcacagacctgcccaatgcctttgat
ggaccaattaccataactattgttaaccccgatggcactcgctatatcaagaaaggagaa
tacagaacgaatcctgaagacatctaccccagcaaccctactgacgatgatgtgagcagc
ggatcctccagtgaaaggagcagcacttcgggaggttacatctttcacaccttttctact
gcacaccccatcccagacgaagacggtccctggatcaccgacagcacagacagaatccct
gctaccactttgatgagcactagtgctacagcaactgagacagcaaccaagaggcaagaa
acccaggattggttttcatggttgtttctaccatcagagtccaagaatcatcttcacaca
acaacacaaatggctggtacgtcttcaaataccatctcagcaggctgggagccaaatgaa
gaaaatgaagatgaaagagacagacacctcagtttttctggatcaggcattgatgatgat
gaagattttatctccagcaccatttcaaccacaccacgggtttttgaccacacaaaacag
aacaaggactggacccagtggaacccaagccattcaaatccggaagtgctacttcagaca
accgcaaggataactgcagatgtagacagaaatggcaccactgctcatgaaggaaactgg
aacccggaagcacatcctcccctcattcaccatgagcatcatgaggaagaagagacccca
tattctacaagcacaatccaggcaattcctagtagtacaactgaagaaacagctacccag
aaggaacagtggtttggcaacagatggcatgagggatatctccaaacacccagagaagac
tcccattcgacaacagggacagctgcctcagctcttaccagccatccaatgcaaggaagg
acaacaccaagcccagaggacagttcctggactgatttctttgacccaatctcacatccc
atgggacgaggtcatcaagcaggaagaaggatggacatggactccagtcatagtacaacg
cttcagcctactgcagatccaaacacaggtttggtggaagacttggacaggacaggacct
ctttcaatgacaacgaagcagagtaattctcagagcttctctacatcacatgaaggcttg
gaagaagataaagaccatccaacaacttctactctgacatcaagcaataggaatgatgtc
acaggtggaagaagagacccaaatcattctgaaggctcaaccactttactggaaggttat
acctctcattacccagacacgaaggaaagcaggaccttcatcccagtgacctcagctaag
actgggtcctttggagttactgaagttactgttggagattccaactctaatgtcaatcac
tccttatcaggagaccaagatgcattctaccccagtggggggtcccataccactcatgga
tctgaatcagctggacactcacatgggagtcaagaaggtggggcaaacacaacctctggt
cctgtaaggacaccccaaattccagaatggctgatcatcttggcatccctcttggccttg
gctttgattcttgcagtttgcattgcagtcaacagtcgaagaaggtgtgggcagaagaaa
aagctagtgatcaacagtggcaatggagctgtggatgatagaaagccaagtggactcaat
ggagaggccagcaagtctcaggaaatggtgcatttggtgaacaaggagccatcagaaact
ccagaccagtttatgacagctgatgagacaaggaacctgcagaacgtggacatgaagatt
ggggtgtaa

DBGET integrated database retrieval system