KEGG   Macaca fascicularis (crab-eating macaque): 101925271
Entry
101925271         CDS       T02918                                 

Gene name
ITGA6
Definition
(RefSeq) integrin subunit alpha 6
  KO
K06485  integrin alpha 6
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04151  PI3K-Akt signaling pathway
mcf04510  Focal adhesion
mcf04512  ECM-receptor interaction
mcf04514  Cell adhesion molecules
mcf04640  Hematopoietic cell lineage
mcf04810  Regulation of actin cytoskeleton
mcf05145  Toxoplasmosis
mcf05165  Human papillomavirus infection
mcf05200  Pathways in cancer
mcf05222  Small cell lung cancer
mcf05410  Hypertrophic cardiomyopathy
mcf05412  Arrhythmogenic right ventricular cardiomyopathy
mcf05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101925271 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101925271 (ITGA6)
   04514 Cell adhesion molecules
    101925271 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101925271 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101925271 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101925271 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101925271 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101925271 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101925271 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101925271 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101925271 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101925271 (ITGA6)
   05414 Dilated cardiomyopathy
    101925271 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    101925271 (ITGA6)
   04515 Cell adhesion molecules [BR:mcf04515]
    101925271 (ITGA6)
   04090 CD molecules [BR:mcf04090]
    101925271 (ITGA6)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101925271 (ITGA6)
  Exosomal proteins of breast milk
   101925271 (ITGA6)
Cell adhesion molecules [BR:mcf04515]
 Integrins
  Integrin alpha subunits
   101925271 (ITGA6)
CD molecules [BR:mcf04090]
 Proteins
  101925271 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 101925271
NCBI-ProteinID: XP_005573548
UniProt: A0A2K5WLW7
Position
12
AA seq 1091 aa
MAAAGQLCLLYLSAGLLPRLGSAFNLDAEEDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIYEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLRRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDMGKVFIYHGSANGINTK
PTQVLKGKSPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKTACGAPSGICLQVKACFEYTAKPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHTDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKITCEPQKEINFLNLKESHNSRK
KREITEKQIDDSRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNST
FLEEYSKLNYLDILVRAFIDVTAAAENIKLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AVLAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQW
ITKWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggctgccgcggggcagctgtgcctgctctacctgtcggccgggctcctgccccggctc
ggctcagccttcaacttggacgctgaggaggacaacgtgatccggaaatatggggacccc
gggagcctcttcggcttctcgctggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgctcgtgggggccccgcgggcagaagcgcttccactgcagagagccaacagaact
ggagggctgtacagctgcgacatcaccgcccgggggccatgcacacgcatcgaatttgat
aacgatgctgaccccacgtcagaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccggggggcaaggtcgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacgaagcaggaatcccgagacatctttgggcggtgttatgtcctgagccagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgattgaga
ggccatgagaaatttggctcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtatttggagccccgggtacttacaactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctatgaagatgggccttatgaagttggt
ggagagactgagcatgatgaaagtctcgttcctgttcctgctaacagttacttaggtttt
tctttggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
cccagagccaatcacagtggagccgtggttttgctaaggagagatatgaagtctgcacat
ctcctccctgagcacatattcgatggagaaggtctggcctcttcatttggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtgaagccaattcgtcttaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctccg
tatgatgacatgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
cctacacaggttctcaagggtaaatcaccttattttggatattcaattgctggaaacatg
gaccttgatcgaaattcctaccctgatgttgctgttggttccctctcagattcagtaact
attttcagatcccggcctgtgattaatattcagaaaaccatcacagtaactcctaataga
attgacctccgccagaaaacagcgtgtggggcgcctagcgggatatgcctccaggttaaa
gcctgttttgaatatactgctaaacccgctggttataatccttcaatatcaattgtgggc
acactcgaagctgaaaaagaaagaagaaaatctgggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatactcaagaactaactctgaaaaggcagaaacagaaa
gtgtgcatggaggaaaccctctggctacaggataatatcagagataaactgcgtcccatt
cccataactgcttcagtggagatccaagaaccaagctctcgtaggcgagttaattcactt
ccagaagttcttccaattctgaattcagatgaacccaagacagctcatactgatgtgcac
ttcttaaaagagggatgtggagacgacaatgtatgtaacagcaaccttaaactagaatac
aaattttgcacccgagaaggaaatcaagataaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaacccaaggaatcccacaaaagatggcgatgacgcccatgaggctaaactg
attgcaacgtttccagacactttgacatattctgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgccaaccagaatggctcgcaagctgactgtgagcttgga
aatccttttaaaagaaattcaagtgttactttttatttggttttaagtacaactgaagtc
acctttgacaccccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctcg
ggagttgctaaaccttcccaggtgtattttggaggtacagttgttggcgagcaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaattaacttaggt
aaacctcttaaaaacctcggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatggcaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaagataact
tgtgagccacaaaaggagataaacttcctgaacctcaaggagtctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagatgatagcagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagcgtgaatgtgaactgtgtgaacatcagatgccca
ctgcgagggctggacagcaaggcgtctcttattttgcgctcgaggttatggaacagcaca
tttctagaggaatattccaaactgaactacttggacattctcgtgcgagccttcattgat
gtgactgctgctgccgaaaatatcaagctgccaaatgcaggcactcaggttcgtgtgact
gtgtttccctcaaagactgtagctcagtattcaggagtaccttggtggatcatcctagtg
gctgttctcgctgggattttgatgcttgctttgttagtgtttatactatggaagtgtgga
ttcttcaaacgctctaggtacgatgacagtgttccccgataccatgctgtaaggatccgg
aaagaagagcgagagatcaaagatgaaaagtatattgataaccttgaaaaaaaacagtgg
atcacaaagtggaacgaaaatgaaagctactcatag

KEGG   Macaca fascicularis (crab-eating macaque): 102114969
Entry
102114969         CDS       T02918                                 

Gene name
ITGA5
Definition
(RefSeq) integrin subunit alpha 5
  KO
K06484  integrin alpha 5
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04151  PI3K-Akt signaling pathway
mcf04510  Focal adhesion
mcf04512  ECM-receptor interaction
mcf04640  Hematopoietic cell lineage
mcf04810  Regulation of actin cytoskeleton
mcf05100  Bacterial invasion of epithelial cells
mcf05133  Pertussis
mcf05135  Yersinia infection
mcf05165  Human papillomavirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05205  Proteoglycans in cancer
mcf05206  MicroRNAs in cancer
mcf05410  Hypertrophic cardiomyopathy
mcf05412  Arrhythmogenic right ventricular cardiomyopathy
mcf05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102114969 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102114969 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102114969 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102114969 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102114969 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102114969 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102114969 (ITGA5)
   05205 Proteoglycans in cancer
    102114969 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102114969 (ITGA5)
   05165 Human papillomavirus infection
    102114969 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102114969 (ITGA5)
   05133 Pertussis
    102114969 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    102114969 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102114969 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102114969 (ITGA5)
   05414 Dilated cardiomyopathy
    102114969 (ITGA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102114969 (ITGA5)
   04515 Cell adhesion molecules [BR:mcf04515]
    102114969 (ITGA5)
   04090 CD molecules [BR:mcf04090]
    102114969 (ITGA5)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102114969 (ITGA5)
Cell adhesion molecules [BR:mcf04515]
 Integrins
  Integrin alpha subunits
   102114969 (ITGA5)
CD molecules [BR:mcf04090]
 Proteins
  102114969 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 102114969
NCBI-ProteinID: XP_005571144
UniProt: A0A2K5W3N7
Position
11
AA seq 1098 aa
MPPRQPPRQAGGGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGSRTPESPLH
AVQLRWGPRRRSPLLPLLLLLLPPPPRVGGFNFDAEAPAVLSGPPGSFFGFSVEFYRPGT
DGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTNNFTQILEYAP
CRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLI
NLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDI
RSLYNFSGEQMASYFGYAVAATDINGDGLDDLLVGAPLLMDRTPDGRPQEVGRVYVYLQH
PAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGG
PGGLGSKPSQILQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRP
IVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQ
KQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALDFS
LDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDK
NALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVC
DLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFQLSVEAQAQ
VTLNGVSKPEAVLFPVSDWHPRDQPQKEEDVGPAVHHVYELINQGPSSISQGVLELSCPQ
ALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHRQKREAPSRSSASSGPQILKC
PEAECLRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRIL
PRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLP
YGTAMEKAQLKPPATSDA
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgcccccccgccagccccctcggcaggcggggggagggctcagccgggagtttggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagagcgggcgctatggggagccggacgccagagtcccctctccac
gccgtgcagctgcgctggggcccccggcgccgatccccgctgctgccgctgctgctactg
ctgctgccgccgccacccagggtcgggggcttcaactttgacgcggaggccccagcagtg
ctctcggggcccccaggctccttcttcggattctcagtggagttttaccggccgggaaca
gacggggtcagtgtgctagtgggagcacccaaggctaacaccagccagccaggagtgctg
cagggtggtgctgtctacctctgtccttggggcgccagccccacacagtgcacccccatt
gaatttgacagcaaaggctctcggctcctggagtcctcactgtccagctcagagggagag
gagcctgtggagtacaagtccttgcagtggttcggggcaacagttcgagcccatggctcc
tccatcttggcgtgcgctccactgtacagctggcgcacagagaaggagccactgagcgac
cccgtgggtacctgctacctctccacaaataacttcacccaaattctggagtatgcacct
tgccgctcagatttcagctgggcagcaggacagggttactgccaaggaggcttcagtgct
gagttcaccaagactggccgtgtggttttaggtggaccaggaagctatttctggcaaggc
cagatcctgtctgccactcaggagcagattgcagaatcttactaccccgagtacctgatc
aacctggttcaggggcagctgcagactcgccaggccagttccatctatgatgacagctac
ctaggatactctgtggctgtaggtgaattcagtggtgatgacacagaagactttgttgct
ggtgtgcccaaagggaacctcacttacggctatgtcaccatccttaatggctcagacatc
cgatccctctacaacttctcaggggaacagatggcctcctacttcggctatgcagtggct
gccacagacatcaatggggacgggctggatgacttgctggtaggggcacccctgctcatg
gatcggacccctgacgggcggcctcaggaggtgggcagggtctacgtctacctgcagcac
ccagccggcatagagcccacgcccacccttaccctcactggccatgatgagtttggccga
tttggcagctccttgacccccctgggggacctggaccaggatggctacaatgatgtggcc
attggggctccctttggtggggagacccagcagggagtagtgtttgtattccctgggggc
cccggagggctgggctctaagccttcccagattctgcaacccctgtgggcagccagccac
accccagacttctttggctctgcccttcgaggaggccgagacctggatggcaacggatac
cctgatctgattgtggggtcctttggtgtggacaaggctgtggtatacaggggccgcccc
atcgtgtctgccagtgcctccctcaccatcttccctgccatgttcaacccagaggagcgc
agctgcagcttagaggggaaccctgtggcctgcatcaaccttagcttctgcctcaatgct
tctggaaaacatgttgctgactccattggcttcacagtggaacttcagctggactggcag
aagcagaagggaggggtacggcgggcactgttcctggcctccaggcaggcaaccctgacc
cagaccctgctcatccagaatggggctcgagaggattgcagagagatgaagatctacctc
aggaatgagtcagaatttcgagacaaactctccccaattcacatcgctctcgacttctcc
ttggacccccaagccccagtggacagccacggcctcaggccagccctgcattaccagagc
aagagccggatagaggacaaggctcagatcttgctggactgtggagaagacaacatctgc
gtgcctgacctgcagctggaagtgtttggggagcagaaccatgtgtacctgggtgacaag
aatgccctaaacctcactttccatgcccagaatgtgggtgagggtggcgcctatgaggct
gagcttcgggtcaccgcccctccagaggctgagtactcaggactcgtcagacatccaggg
aacttctccagcctgagctgtgactactttgccgtgaaccagagccgcctgctggtgtgt
gacctgggcaaccccatgaaggcaggagccagtctgtggggtggccttcggtttacagtc
cctcatctccgggacactaagaaaaccatccagtttgacttccagatcctcagcaagaat
ctcaacaactcgcaaagtgacgtggtttccttccagctctccgtggaggctcaggcccag
gtcaccctgaacggtgtctccaagcctgaggcagtgctattcccagtaagcgactggcat
ccccgagaccagcctcagaaggaggaggacgtgggacctgctgtgcaccatgtctatgag
ctcatcaaccaaggccccagctccatcagccagggcgtgctggagctcagctgtccccag
gctctggaaggtcagcagctcctatatgtgaccagagttacgggactcaactgcaccacc
aatcaccccattaacccaaaaggcctggagttggatcccgagggttccctgcaccaccgg
caaaaacgggaagctccaagccgcagctctgcttcctctggacctcagatcctgaaatgc
ccggaggctgagtgtttgaggctgcgctgtgagctcgggcccctgcaccaacaagagagc
caaagtctgcagctgcatttccgagtctgggccaagactttcttgcagcgggagcaccag
ccatttagcctgcagtgtgaggctgtgtacaaagccctgaagatgccctaccgaatcctg
cctcggcagctgccccaaaaggagcgtcaggtggccacagctgtgcaatggaccaaggca
gaaggcagctatggcgtcccactgtggatcatcatcctagccatcctttttggcctcctg
ctcctaggtctactcatctacatcctctacaagctcggattcttcaaacgctccctccca
tatggcaccgccatggaaaaagctcagctcaagcctccagccacctctgatgcctga

KEGG   Macaca fascicularis (crab-eating macaque): 102123329
Entry
102123329         CDS       T02918                                 

Gene name
ITGA3
Definition
(RefSeq) integrin subunit alpha 3
  KO
K06482  integrin alpha 3
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04151  PI3K-Akt signaling pathway
mcf04510  Focal adhesion
mcf04512  ECM-receptor interaction
mcf04640  Hematopoietic cell lineage
mcf04810  Regulation of actin cytoskeleton
mcf05165  Human papillomavirus infection
mcf05200  Pathways in cancer
mcf05222  Small cell lung cancer
mcf05410  Hypertrophic cardiomyopathy
mcf05412  Arrhythmogenic right ventricular cardiomyopathy
mcf05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102123329 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102123329 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102123329 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102123329 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102123329 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102123329 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102123329 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102123329 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102123329 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102123329 (ITGA3)
   05414 Dilated cardiomyopathy
    102123329 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102123329 (ITGA3)
   04515 Cell adhesion molecules [BR:mcf04515]
    102123329 (ITGA3)
   04090 CD molecules [BR:mcf04090]
    102123329 (ITGA3)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102123329 (ITGA3)
Cell adhesion molecules [BR:mcf04515]
 Integrins
  Integrin alpha subunits
   102123329 (ITGA3)
CD molecules [BR:mcf04090]
 Proteins
  102123329 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 FG-GAP_2 MTABC_N MLANA
Other DBs
NCBI-GeneID: 102123329
NCBI-ProteinID: XP_005583700
UniProt: A0A2K5VFM7
Position
16
AA seq 1049 aa
MGPGPSRAPRAPRLMLCALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQT
ERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKSDPGHHIIEDM
WLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDPSDDWQTYHN
EMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDP
EDQGNLYIGYTVQVGSAILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEGSQ
VGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGTSFPAHPSLLLH
GPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLPRQPQQVIHGEKL
GLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVARPAVLDP
ALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGF
FSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQA
LENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRT
SEHTGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEV
IGVTLHTRDLQVQLQLSTSSHQDNLWPMTLTLLVDYTLQTSLSMVNHRLQSFFGGTVMGE
SGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITIHGNG
SWPCQPPGDLVNPLNLTLSDPGDRLSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVL
TCATGRARCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSI
PTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRA
RTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3150 nt   +upstreamnt  +downstreamnt
atgggccctggccccagccgcgcgccccgcgccccacgcttgatgctttgcgcgttgatg
gtggcggccggcggctgcgtcgtctccgccttcaacctggatacccgattcctggtagtg
aaagaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcggcagaca
gagcggcagcagcgctacctgctcctggctggtgccccccgggagctcgctgtgcctgat
ggctacaccaaccggactggtgctgtgtacctgtgcccactcactgcccacaaggatgac
tgtgagcggatgaacatcacagtgaaaagtgaccctggccatcacattattgaggacatg
tggcttggagtgactgtggccagccagggccctgcaggcagagtcctggtctgtgcccac
cgctacacccaggtgctgtggtcggggtcagaagaccagcggcgcatggtgggcaagtgc
tacgtgcgaggcaatgacctagagttggaccccagtgacgactggcagacctaccacaac
gagatgtgcaacagcaacactgactacctggagacgggcatgtgccagctgggcaccagc
ggtggcttcacccagaacactgtgtacttcggcgcccccggtgcctacaactggaaagga
aacagctacatgattcagcgtaaggagtgggacttatctgagtatagttacaaggaccca
gaggaccaaggaaacctctatattgggtacacggtgcaggtaggcagcgccatcttgcac
cccaaaaacatcaccattgtgacaggtgccccacggcaccgacatatgggcgcggtcttc
ttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggctcgcag
gtgggcgcctattttggcagcgccattgccctggcagacctgaacaacgatgggtggcag
gacctcctggtgggcgccccctactactttgagaggaaagaggaggtagggggtgccgtc
tatgtcttcatgaaccaggcgggaacctccttccctgctcacccctcgcttcttcttcat
ggccccagtggctccgccttcggcttatccgtggccagcattggtgacatcaaccaggat
ggatttcaggatattgctgtgggagctccatttgaaggcttgggcaaagtgtacatctat
cacagtagctctaaggggctccccagacagccccagcaggtaatccacggagagaagctg
ggactgcctggcttggccaccttcggctattccctcagtgggcagatggatgtggatgag
aacttctacccagaccttctagtgggaagcctgtcagaccacattgtgctgctgcgggcc
cggcccgtcatcaacatcgtccacaagaccttggtggccaggcccgctgtgctggaccct
gcactttgcacggccacctcctgtgtgcaagtggagctgtgctttgcttacaaccagagt
gccgggaaccccaactacaggcgaaacatcaccctggcctacactctggaggctgacagg
gaccgccgcccgccccggctccgctttgctggcagtgagtctgctgtcttccacggcttc
ttctccatgcccgagatgcgctgccagaagctggagctgctcctgatggacaacctccgt
gacaaactccggcccatcatcatctccatgaactactctttacctttgcggatgcccgat
cgcccccggctggggctgaggtccctggacgcctacccgatcctcaaccaggcacaggct
ctggagaaccacactgaggtccagttccagaaggagtgcgggcctgacaacaagtgtgag
agcaacttgcagatgcgggcagccttcgtgtccgagcagcagcagaagctgagcaggctc
cagtacagcagagacgtccggaaactgctcctgagcatcaacgtgacgaacacccggacc
tcggagcacaccggagaggacgcccacgaggcactgcttaccctggtggtgcctcccgcc
ctgctgctgtcctcagtgcgcccccctggggcctgccaagctaatgagaccatcttttgc
gagctggggaaccccttcaaacggaaccagaggatggagctgctcatcgcctttgaggtc
atcggggtgaccctgcacacaagggaccttcaggtgcagctgcagctctccacgtcaagt
caccaggacaacctgtggcccatgaccctcactctgctggtggactatacactccagacc
tcgcttagcatggtaaatcaccggctacaaagcttctttggggggacagtgatgggcgag
tctggcatgaaaactgtggaggatgtaggaagccccctcaagtacgaattccaggtgggc
ccaatgggggaggggctggtgggcctggggaccctggtcctaggtctggaatggccctat
gaagtcagcaatggcaagtggctgctgtatcccacggagatcaccatccatggcaatggg
tcctggccctgccaaccacctggagaccttgtcaaccctctcaacctcactctttctgac
cctggggacaggctgtcatccccacagcgcaggcggcgacagctggatccagggggaggc
cagggtcccccacctgtcactctggctgctgccaaaaaagccaagtctgagactgtgctg
acctgtgccacagggcgtgcccgctgtgtgtggctggagtgccccatccctgatgccccc
gttgtcaccaacgtgactgtgaaggcacgagtgtggaacagcaccttcattgaggattac
agagactttgaccgagtccgggtaaatggctgggctaccctgttcctccgaaccagtatc
cccaccatcaacatggagaacaagaccacgtggttctccgtggacattgactcggagctg
gtggaggagctgccggctgagatcgagctgtggctggtgctggtggccgtgggtgcgggg
ctgctgcttctggggctgatcattctcctgctgtggaagtgcggcttcttcaagcgagcc
cgcactcgcgccctgtatgaagctaagaggcagaaggcggagatgaagagccagccgtca
gagacagagaggctgaccgacgactactga

KEGG   Macaca fascicularis (crab-eating macaque): 102128433
Entry
102128433         CDS       T02918                                 

Gene name
ITGA4
Definition
(RefSeq) integrin subunit alpha 4
  KO
K06483  integrin alpha 4
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04151  PI3K-Akt signaling pathway
mcf04510  Focal adhesion
mcf04512  ECM-receptor interaction
mcf04514  Cell adhesion molecules
mcf04640  Hematopoietic cell lineage
mcf04670  Leukocyte transendothelial migration
mcf04672  Intestinal immune network for IgA production
mcf04810  Regulation of actin cytoskeleton
mcf05135  Yersinia infection
mcf05140  Leishmaniasis
mcf05165  Human papillomavirus infection
mcf05410  Hypertrophic cardiomyopathy
mcf05412  Arrhythmogenic right ventricular cardiomyopathy
mcf05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102128433 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102128433 (ITGA4)
   04514 Cell adhesion molecules
    102128433 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102128433 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102128433 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102128433 (ITGA4)
   04670 Leukocyte transendothelial migration
    102128433 (ITGA4)
   04672 Intestinal immune network for IgA production
    102128433 (ITGA4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102128433 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102128433 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102128433 (ITGA4)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102128433 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102128433 (ITGA4)
   05414 Dilated cardiomyopathy
    102128433 (ITGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102128433 (ITGA4)
   04515 Cell adhesion molecules [BR:mcf04515]
    102128433 (ITGA4)
   04090 CD molecules [BR:mcf04090]
    102128433 (ITGA4)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102128433 (ITGA4)
  Exosomal proteins of other cancer cells
   102128433 (ITGA4)
Cell adhesion molecules [BR:mcf04515]
 Integrins
  Integrin alpha subunits
   102128433 (ITGA4)
CD molecules [BR:mcf04090]
 Proteins
  102128433 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha DUF11
Other DBs
NCBI-GeneID: 102128433
NCBI-ProteinID: XP_005573683
UniProt: A0A2K5U6S2
Position
12
AA seq 1032 aa
MAWEARREPGPRRAALRETVMLLLCLGVPTGRPYNVDTESALLYQGPPNTLFGYSVVLHS
QGANRWLVVGAPTANWLANASVINPGAIYRCRIGKNPGRTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGMPPDLRTELSKRI
APCYQDYVKKFGEYFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
RQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELSILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNEMETNLVG
SDKYAARFGECIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGVSSVFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVEASLSHPESVN
RTKFDCVENGWPSVCMDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKTESPPRFYFSSNGT
SDVITGSIQVSSGVANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQ
PILQQKKEKDIIKKTISFARFCAHENCSADLQVSAKFGFFKPHENKTYLAVGSMKTLMLN
VSLFNAGDDAYETTLHVKLPMGLYFIKILELEEKQINCEVTDNSGMVQLDCSIGYIYVDH
LSRIDISFLLDVSSLSRAEEDLNITVHATCENEGEMDNLKHSRVTVAIPLKYEVKLTVHG
FVNPTSFVYGSNDENEPEMCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF
NILDVQTTTGECHFENYQRVCALEQQKSAMHTLKGMFQFLSKTDKRLLYCIKADPHCLNF
LCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATSFPEPNSRVIELNKDENVA
HVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRD
SWSYINSKSNDD
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcttgggaagcgaggcgcgaacctggtccccgaagggccgccctccgggagacggtg
atgttgttgctgtgcctgggggtcccgaccggccgcccctacaacgtggacactgagagc
gcgctgctttaccagggcccccccaacacgctgttcggctactcggtcgtgctgcacagc
caaggggcgaacagatggctcgtggtgggtgcgcccactgccaactggctcgccaacgct
tcagtgatcaatcccggggcgatttacagatgcaggatcgggaagaatcccggccggacg
tgcgaacagctccagctgggtagccctaatggagaaccttgtggaaagacttgtttggaa
gagagagacaatcagtggttgggggtcacactttccagacagccaggagaaaatggatcc
atcgtgacttgtgggcatagatggaaaaatatattttacataaagaatgaaaataagctc
cccactggtggttgctatggaatgccccctgatttacgaacagaactgagtaaaagaata
gctccgtgttatcaagattatgtgaaaaaatttggagaatattttgcatcatgtcaagct
ggaatatctagtttttacacaaaggatttaattgtgatgggagccccaggatcatcttat
tggactggctctctctttgtctacaatataactacaaataaatacaaggcttttttagac
agacaaaatcaagtaaaatttggaagttatttaggatattcagttggagctggtcatttt
cggagtcagcatactactgaagtagttggaggagctcctcaacacgagcagattggtaaa
gcatatatattcagcattgatgaaaaagaactaagtatcttacatgaaatgaaaggtaaa
aagcttggatcgtactttggagcttctgtctgtgctgtggaccttaacgcagatggcttc
tcagatctgctcgtgggagcgcccatgcagagcaccatcagagaggaaggaagagtgttt
gtgtacatcaactccggctcgggagcagtaatgaatgaaatggaaacaaacctcgttgga
agtgacaaatatgctgcaagatttggcgaatgtatagttaatcttggtgacattgacaat
gatggctttgaagatgttgctattggagctccacaagaagatgacttgcaaggtgctatt
tatatttacaatggtcgtgcagatggggtctcatcagtcttctcgcagagaatcgaagga
cttcagatcagcaaatcgttaagtatgtttggacagtctatatcaggacaaattgatgca
gataataatggatatgtagatgtagcagttggtgcttttcggtctgattctgctgtgttg
ctaaggacaagacctgtagtcattgttgaagcttctttaagccaccctgagtcagtaaat
agaacgaaatttgactgtgttgaaaatggatggccttctgtgtgcatggatctaacactt
tgtttctcatataagggcaaggaagttccaggttacattgttttgttttataacatgagt
ttggatgtgaacagaaagacagagtctccaccaagattctatttttcttctaatggaact
tctgacgtgattacaggaagcatacaagtgtccagcggagtagctaactgtagaacacat
caagcatttatgcggaaagatgtgcgggacatccttaccccaattcagattgaagctgct
taccaccttggtcctcacgtcatcagtaaacgaagcacagaggaattcccaccacttcag
ccaattcttcagcagaagaaagaaaaagacataattaaaaaaacaataagctttgcaagg
ttttgtgcccatgaaaattgttctgctgatttacaggtttctgcaaagtttgggtttttc
aagccccatgaaaataaaacctaccttgctgttgggagtatgaagacattaatgttgaat
gtgtccttgtttaatgctggagatgatgcatatgaaacgactctacatgtcaaactaccc
atgggtctttacttcattaagattttagagctggaagagaagcaaataaactgtgaagtc
acagataactctggcatggtacaacttgactgcagtattggctatatatatgtagatcat
ctctcaaggatagatattagctttctcctggatgtgagctcactcagcagagcggaagag
gacctcaatatcacagtgcatgctacctgtgaaaatgaaggggaaatggacaatctaaag
cacagcagagtgactgtagcaatacctttaaaatatgaggttaagctgactgttcatggg
tttgtaaacccaacttcatttgtgtatggatcaaatgatgaaaatgagcctgaaatgtgc
atggtggagaaaatgaacttaactttccatgttatcaacactggcaatagcatggctcct
aatgttagtgtggaaataatggtaccaaattctttcagcccccaaactgataagctgttc
aacattttggatgtccagactactactggagaatgccactttgaaaattatcaaagagta
tgtgcattagagcagcaaaagagtgcaatgcacaccttgaaaggcatgttccagttcttg
tccaagactgataagaggctattgtactgcataaaagctgatccacattgtttaaatttc
ctatgtaatttcgggaaaatggaaagtggaaaagaagccagtgttcatatccagttggaa
ggccgaccatccattttagaaatggatgagacttcagcactcaaatttgaaataagagca
acaagttttccagagccaaattcaagagttattgaactaaacaaggatgagaatgttgca
catgttctcctggaaggactacatcatcaaagacccaaacgttatttcaccatagtgatt
atttcaagtagcttgctacttggacttattgtacttctgttgatctcatatgttatgtgg
aaggccggcttctttaaaagacaatacaaatctatcctacaagaagaaaacagaagagac
agctggagttacatcaacagtaaaagcaatgatgattaa

KEGG   Macaca fascicularis (crab-eating macaque): 102132675
Entry
102132675         CDS       T02918                                 

Gene name
ITGA1
Definition
(RefSeq) integrin subunit alpha 1
  KO
K06480  integrin alpha 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04151  PI3K-Akt signaling pathway
mcf04510  Focal adhesion
mcf04512  ECM-receptor interaction
mcf04640  Hematopoietic cell lineage
mcf04810  Regulation of actin cytoskeleton
mcf05165  Human papillomavirus infection
mcf05410  Hypertrophic cardiomyopathy
mcf05412  Arrhythmogenic right ventricular cardiomyopathy
mcf05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102132675 (ITGA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102132675 (ITGA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102132675 (ITGA1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102132675 (ITGA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102132675 (ITGA1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102132675 (ITGA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102132675 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102132675 (ITGA1)
   05414 Dilated cardiomyopathy
    102132675 (ITGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102132675 (ITGA1)
   04515 Cell adhesion molecules [BR:mcf04515]
    102132675 (ITGA1)
   04090 CD molecules [BR:mcf04090]
    102132675 (ITGA1)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102132675 (ITGA1)
Cell adhesion molecules [BR:mcf04515]
 Integrins
  Integrin alpha subunits
   102132675 (ITGA1)
CD molecules [BR:mcf04090]
 Proteins
  102132675 (ITGA1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 FG-GAP_2 LYRIC HisK_sensor Integrin_alpha VWA_CoxE Cation_ATPase_N
Other DBs
NCBI-GeneID: 102132675
NCBI-ProteinID: XP_005556933
UniProt: A0A2K5WHV8
Position
6
AA seq 1179 aa
MAPRPRARPGVAVACCWLLTVVLRCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKNRTGDVYKCPVGRGESLPCVKMDLPVNTSIPNVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVRECSTQLDIVIVLDGS
NSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKASQIIIPRNTT
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQT
LSGEQIGSYFGSILTTIDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQM
SLEPTKQTCCSSRQHNSCTKENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHG
GAVYIYHGSGKTIRKEYAQRIPSGGDGETLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRKGEMVT
FKILFQFNTSYLMENVTIYLNATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
ISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPT
GLSSSDNANCRPHIFEDPFSIDSGKKMTTSTDHLKQGTILDCNPCKFATITCNLTPSDMS
QVNVSLILWKPTFIKSYFSSLNLTIRGELRSENTSLVLSSSNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3540 nt   +upstreamnt  +downstreamnt
atggcccctcggccccgcgcccgcccaggggtcgctgtcgcctgctgctggctcctcact
gttgttctacgctgctgcgtatcattcaatgttgatgtgaaaaattcgatgactttcagc
ggcccagtggaagacatgtttggatatactgttcaacaatatgaaaatgaagaaggaaaa
tgggtgcttattggttctcctttagttggccaacccaaaaacagaactggagatgtctat
aagtgtccagttgggagaggtgaatcattaccttgtgtaaagatggatctaccagttaat
acatcaattcccaatgtcacagaagtaaaagagaacatgacatttggatcaactttagtc
accaacccaaacggaggatttttggcatgtgggcccttatatgcctatagatgtggacat
ttgcattacacaactggaatctgttctgacgtcagtcccacatttcaagtcgtgaattcc
attgcccctgtaagagaatgcagcactcaactggacatagtcatagtgctagatggttcc
aacagtatttacccatgggacagtgttacagcttttttaaatgaccttcttgaaagaatg
gatattggtcctaaacagacacaggttggaattgtacagtatggagaaaacgtgacccat
gagttcaacctcaataagtattcttccaccgaagaggtacttgttgcagcaaagaaaata
gtccagagaggtggccgccagactatgacagctcttggaatagacacagcaagaaaggag
gcattcacggaagcccggggtgcccgaagaggagttaaaaaagtcatggttattgtgacg
gatggagagtcccatgacaaccatcgactgaagaaggtcattcaagactgtgaagatgaa
aacattcaacggttttccatagctattcttggcagctataaccgaggaaatttaagcact
gaaaaatttgtggaggaaataaaatcaattgcaagcgaacccactgaaaagcatttcttc
aatgtctctgatgaattggctctagtcaccattgttaaaactctgggagaaagaatattt
gccctggaagctacagctgaccagtcagcagcttcatttgaaatggaaatgtctcagact
ggcttcagtgctcattattcacaggactgggtcatgcttggagcagtaggagcctatgat
tggaatggaacagttgtcatgcagaaggctagtcaaataatcatccctcgaaacacaacc
tttaacgttgagtctaccaaaaagaatgaaccgcttgcttcttatttaggttacactgta
aactctgctactgcttcttctggagatgtgctctatattgctggacagcctcggtacaat
catacaggccaggtcattatctacaggatggaagatggaaacatcaaaattctccagaca
ctcagtggagaacagattggttcctactttggcagtattttaacaacaattgacattgac
aaggattctaatactgacattcttctagtcggagcccctatgtacatgggaacggagaaa
gaggagcaaggaaaagtgtatgtgtatgctctcaatcagacaaggtttgaatatcaaatg
agcctggaacctactaagcagacgtgctgttcatctcggcagcacaattcatgcacaaaa
gaaaacaaaaatgagccatgcggggctcgttttggaactgctattgctgctgtaaaagat
ctcaatcttgatggatttaatgacatcgtgataggagctccgctggaagatgatcacggg
ggagctgtgtacatttatcatggaagtggcaagacgataaggaaagagtatgcacaacgt
attccatcaggtggggatggtgagacactgaaattttttggccagtctatccacggagaa
atggatttaaatggtgacggcctgacagatgtgactattgggggccttggtggtgctgcc
ctcttctggtcccgagatgtggccgtagttaaagtgaccatgaattttgaaccaaataaa
gtgaatattcaaaagaaaaactgccatatggagggaaaggaaacagtatgcataaatgct
acagtgtgttttgatgtgaaattaaaatctaaagaagacacgatttatgaagctgatttg
cagtaccgtgtcaccctagattcactaaggcaaatatcacgaagttttttctctggaact
caggagagaaaagttcaaaggaacatcacagttcgaaaatcagaatgcactaagcactcc
ttctacatgttggacaagcatgactttcaggactctgtgagaataacgttggactttaat
cttaccgatccagaaaatgggcctgttcttgatgattctctaccgaactcagtacatgaa
tatattccttttgccaaagattgtggaaacaaggaaaaatgtatctcggacctcagcctg
catgtcgccaccacagaaaaggacctgctaattgtccggtcccagaatgataagttcaat
gttagcctcacagtcaaaaatacaaaggacagtgcctacaataccaggacaatagtgcat
tattctccaaatctagttttttcaggaattgaggctatccaaaaagacagttgtgaatcc
aatcataatatcacatgtaaagttggatatcccttcctgagaaaaggagagatggtaact
ttcaaaatattgtttcagtttaacacatcctatctcatggaaaatgtgaccatttattta
aatgcaacaagcgacagtgaagaacctcctgaaaccctttctgataatgtagtaaacatt
tctattccggtaaaatatgaagttggactacagttttacagctctgcaagtgaataccac
atttcaattgctgccaatgagacagtccctgaagttattaattctacggaggacattgga
aatgaaattaatatcttctacctgattagaaaaagtggatcttttccaatgccagaactt
aagctgtcaatttcattccccaacatgacatcaaatggttatcctgtgctatacccaact
ggattgtcatcttctgataatgcaaactgcagaccccatatctttgaggatcctttcagt
atagactctggaaagaaaatgactacatcaactgaccatctcaaacaaggcacaattctg
gactgcaatccatgtaaatttgctaccatcacatgtaatctcactccttctgacatgagc
caagtgaatgtttcacttatcttgtggaaaccaacttttataaaatcatatttttccagc
ttaaatcttactataaggggagaacttcggagtgaaaatacatcactggttttaagtagc
agcaatcaaaaaagagagcttgctattcaaatatccaaagatggactaccgggcagagtg
ccattatgggtcatcctgctgagtgcttttgctggattattgctgttaatgctgctcatt
ttagcactgtggaagattggattcttcaaaagaccactgaaaaagaaaatggagaaatga

KEGG   Macaca fascicularis (crab-eating macaque): 102133302
Entry
102133302         CDS       T02918                                 

Gene name
ITGA2
Definition
(RefSeq) integrin subunit alpha 2
  KO
K06481  integrin alpha 2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04145  Phagosome
mcf04151  PI3K-Akt signaling pathway
mcf04510  Focal adhesion
mcf04512  ECM-receptor interaction
mcf04611  Platelet activation
mcf04640  Hematopoietic cell lineage
mcf04810  Regulation of actin cytoskeleton
mcf05165  Human papillomavirus infection
mcf05200  Pathways in cancer
mcf05205  Proteoglycans in cancer
mcf05222  Small cell lung cancer
mcf05410  Hypertrophic cardiomyopathy
mcf05412  Arrhythmogenic right ventricular cardiomyopathy
mcf05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102133302 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102133302 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102133302 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102133302 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102133302 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102133302 (ITGA2)
   04611 Platelet activation
    102133302 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102133302 (ITGA2)
   05205 Proteoglycans in cancer
    102133302 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102133302 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102133302 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102133302 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102133302 (ITGA2)
   05414 Dilated cardiomyopathy
    102133302 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102133302 (ITGA2)
   04515 Cell adhesion molecules [BR:mcf04515]
    102133302 (ITGA2)
   04090 CD molecules [BR:mcf04090]
    102133302 (ITGA2)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102133302 (ITGA2)
  Exosomal proteins of bladder cancer cells
   102133302 (ITGA2)
Cell adhesion molecules [BR:mcf04515]
 Integrins
  Integrin alpha subunits
   102133302 (ITGA2)
CD molecules [BR:mcf04090]
 Proteins
  102133302 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 FG-GAP_3 Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 102133302
NCBI-ProteinID: XP_005556934
UniProt: G8F2Z5 A0A2K5UXK0
Position
6
AA seq 1180 aa
MGPGRTGSSPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPAAQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQHGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSPQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNVTVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNDLKKEEGRVYLFTIKKGILSQH
QFLEGPEGIENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTVRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADIAIEAS
FTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETTKV
FSIPFHKDCGEDGLCIADLVLDVRQIPAAQEQPFTVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENEPDNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDIGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSVSFKSENFRHTKELNCRTASCSNVTCWLKDLHMKGEYFVNVTTRIWN
GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPIGVIIGSIIA
GILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELNS
NT seq 3543 nt   +upstreamnt  +downstreamnt
atgggaccaggacggacagggtcctcgccgctgccgctgctgctggtgttagcgctcagt
caaggcattttaaattgttgtttggcatacaatgttggtctcccagaagcaaaaatattt
tccggtccttcaagtgaacagtttggctatgcagtgcagcagttcataaatccaaaaggc
aactggttacttgttggttcaccctggagtggctttcctgagaaccgaatgggagatgtg
tataagtgtcctgttgacctatccactgccacatgtgaaaaactaaatttgcaaacttca
acaagcattccaaatgttactgagatgaaaaccaacatgagcctcggcttgaccctcaca
aggaacatgggaactggagggtttctcacatgtggtcctctgtgggcacagcagtgtggg
aatcagtattacacaacgggtgtgtgttctgacatcagtcctgattttcagctctcagcc
agcttctcacctgcagctcagccgtgcccttccctcatagatgttgtggttgtgtgtgat
gaatcaaatagtatttatccttgggatgcagtgaagaattttttggaaaaatttgtacaa
ggcctggatataggccccacaaagacacaggtggggttaattcagtatgccaataatcca
agagttgtgtttaacttgaacacatataaaaccaaagaagaaatgattgtagcaacatcc
cagacatcccaacatggtggggacctcacaaacacattcggagcaattcaatatgcaaga
aaatatgcttattcagcagcttctggtggacgacgaagtgctaccaaagtaatggtagtt
gtaactgatggtgaatcacatgatggttcaatgttgaaagctgtgattgatcaatgcaac
catgacaatatactgaggtttggtatagcagttcttgggtacttaaacagaaatgccctt
gatactaaaaatttaataaaagaaataaaagcaatcgctagtattccaacagaaagatac
tttttcaatgtgtctgatgaagcagctctactagaaaaggctgggacattaggagaacaa
attttcagcattgaaggtactgttcaaggaggagacaactttcagatggaaatgtcacaa
gtgggattcagtgcagattactctcctcaaaatgatattctgatgctgggtgcagtggga
gcttttggctggagtgggaccattgtccagaagacatctcatggccatttgatctttcct
aaacaggcctttgaccaaattctgcaggacagaaatcacagttcatatttaggttactct
gtggctgcaatttctactggagaaagcacccactttgttgctggtgctcctcgggcaaat
tataccggccagatagtgctgtacagtgtgaatgagaatggcaatgtcacagttattcag
gctcaccgaggtgaccagattggctcctatttcggtagcgtgctatgttcagttgatgtg
gataaagacaccattacagatgtgctcttggtaggtgcaccaatgtacatgaatgaccta
aagaaagaggaaggaagagtctacctgtttactatcaaaaagggcattttgagtcagcac
caatttcttgaaggccccgagggcattgaaaatgctcgatttggttcagcaattgcagct
ctttcagacatcaacatggatggctttaacgatgtgattgttggttcgccactagaaaat
cagaattctggagctgtatacatttataatggtcatcagggcactgtccgcacgaagtat
tcccagaaaatcttgggatccgatggagcctttaggagccatctccagtactttgggagg
tccttggatggctatggagatttaaatggggattccatcactgatgtgtccattggtgcc
tttggacaagtggttcaactctggtcacaaagtattgctgatatagctatagaagcttca
ttcacaccagaaaaaatcactttggtcaataagaatgctcagataattctcaaactctgc
ttcagtgcaaagttcagacctactaagcaaaacaatcaagtggccattgtatataacatc
acacttgatgcagatggattttcatccagagtaacctccagggggttatttaaagaaaac
aatgaaaggtgcctgcagaagaatatggtagtaaatcaagcacagagttgccccgagcac
atcatttatatacaggagccctctgatgttgtcaactctttggatttgcgtgtggacatc
agtctggaaaaccctggcactagccctgcccttgaagcctattctgagactaccaaggtc
ttcagtattcctttccacaaagactgtggtgaggatggactttgcattgctgatctagtt
ctagatgtccgacaaataccagctgctcaagaacaaccctttactgtcagcaaccaaaac
aaaaggttaacattttcagtaacactgaaaaacaaaagggaaagtgcatacaacactgga
attgttgttgatttttcagaaaacttgttttttgcatcattctccctgccggttgatggg
acagaagtaacatgccaggtggctgcatctcagaagtctgttgcctgtgatgtaggctac
cctgctttaaagagagaacaacaggtgacctttactattaacttcgacttcaatcttcaa
aaccttcagaatcaggcatctctcagtttccaagccttaagtgaaagccaagaagaaaac
gaacctgataatttggtcaacctcaaaattcctctcctgtatgatgctgaaattcactta
acaagatctaccaacataaatttttatgaaatctcttcggatgggaatgttccttcaatc
gtgcacagttttgaagatattggtccaaaattcatcttctccctgaaggtaacaacagga
agtgttccagtaagcatggcaactgtaatcatccacatccctcaatataccaaagaaaag
aacccactgatgtacctaactggggtgcaaacagacaaggctggtgacatcagttgtaat
gcagatatcaatccactgaaaataggacaaacatcttctgtatctttcaaaagtgaaaat
ttcaggcacaccaaagaattgaactgcagaactgcttcctgtagtaatgttacctgctgg
ttgaaagaccttcacatgaaaggagaatactttgttaatgtgactacaagaatttggaac
gggacttttgcatcatcaacgttccagacagtacagctaacggcagctgcagaaatcaac
acctacaaccccgagatatacgtgatcgaagataacactgtgacgattcccctgatgata
atgaaacctgatgagaaagccgaagtaccaataggagttataataggaagtataattgct
ggaatccttttgctgttagctctggttgcaattttatggaagctcggcttcttcaaaaga
aaatatgaaaagatgaccaaaaatccagatgagattgacgagaccacagaactcaatagc
tga

DBGET integrated database retrieval system