KEGG   Macaca fascicularis (crab-eating macaque): 101925772
Entry
101925772         CDS       T02918                                 

Gene name
MME
Definition
(RefSeq) membrane metalloendopeptidase
  KO
K01389  neprilysin [EC:3.4.24.11]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04614  Renin-angiotensin system
mcf04640  Hematopoietic cell lineage
mcf04974  Protein digestion and absorption
mcf05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101925772 (MME)
  09152 Endocrine system
   04614 Renin-angiotensin system
    101925772 (MME)
  09154 Digestive system
   04974 Protein digestion and absorption
    101925772 (MME)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101925772 (MME)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcf01002]
    101925772 (MME)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    101925772 (MME)
   04090 CD molecules [BR:mcf04090]
    101925772 (MME)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.11  neprilysin
     101925772 (MME)
Peptidases and inhibitors [BR:mcf01002]
 Metallo peptidases
  Family M13: neprilysin family
   101925772 (MME)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101925772 (MME)
CD molecules [BR:mcf04090]
 Proteins
  101925772 (MME)
SSDB
Motif
Pfam: Peptidase_M13_N Peptidase_M13
Other DBs
NCBI-GeneID: 101925772
NCBI-ProteinID: XP_005546216
UniProt: A0A2K5X580 G7NZK8
Position
2
AA seq 750 aa
MGRSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATAEPCADFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKD
VLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGA
SWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLY
NKMTLAQLQSNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILT
KYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgggcagatcagaaagtcagatggatataactgatatcaacactccaaagccaaagaag
aaacagcgatggactccgctagagatcagcctctcggtccttgtcctgctcctcaccatc
atagctgtgacaatgatcgcgctctatgcaacctacgatgatggtatttgcaagtcatca
gactgcataaaatcagctgctcgactgatccaaaacatggatgccaccgctgagccttgt
gcagactttttcaaatatgcctgcggaggctggttgaaacgcaatgtcattcctgagacc
agctcccgttacggcaactttgacattttaagagatgaactagaagtcgttttgaaagat
gtccttcaagaacccaaaactgaagatatagtagcagtgcagaaagcaaaaacattgtac
aggtcttgtataaatgaatctgctattgatagcagaggtggagaacctcttctgaaactg
ttaccagatatatatgggtggccagtagcaacagaaaactgggagcaaaaatatggtgct
tcttggacagctgaaaaagctattgcacaactgaattctaaatatgggaaaaaagtcctt
attaatttgtttgttggcactgatgataagaattctgtgaatcatgtaattcatattgac
caacctcgacttggcctcccttctagagattactatgaatgcactggaatctataaagag
gcttgtacagcatatgtggattttatgatttctgtggccagattgattcgtcaggaagaa
agattgcccatcgatgaaaaccagcttgctttggaaatgaataaagttatggaattggaa
aaagaaattgccaatgctacggctaaacctgaagatcgaaatgatccgatgcttctttat
aacaagatgacattggcccagctccaaagtaacttttcattagagatcaatgggaagcca
ttcagctggttaaatttcacaaatgaaatcatgtcaactgtgaatattagtattacaaat
gaggaagatgtggttgtttatgctccagaatatttaaccaaacttaagcccattcttacc
aaatattctgccagagatcttcaaaatttaatgtcctggagattcataatggatcttgta
agcagcctcagccgaacctacaaggagtccagaaatgctttccgcaaggccctttatggt
acaacctcagaaacagcaacttggagacgttgtgcaaactatgtcaatgggaatatggaa
aatgctgtggggaggctttatgtggaagcagcatttgctggagagagtaaacacgtggtt
gaggatttgattgcacagatccgagaagtttttattcagactttagatgatctcacttgg
atggatgctgagaccaaaaagagagctgaagaaaaggccttagcaattaaagaaaggatc
ggctatcctgatgacattgtttcaaatgataacaaactgaataatgagtacctcgagttg
aactacaaagaagatgaatacttcgagaacataattcaaaatctgaaattcagccaaagt
aaacaactaaagaagctccgagaaaaggtggacaaagacgagtggataagtggagcagct
gtagtcaatgcattttactcttcaggaagaaatcagatagtcttcccagccggcattctg
cagccccccttctttagtgcccagcagtccaactcattgaactatgggggcatcggcatg
gtcataggacacgaaatcacccatggctttgatgacaatggcagaaactttaacaaagat
ggagacctggttgactggtggactcaacagtctgcaagtaactttaaagagcaatcccaa
tgcatggtgtatcagtatggaaacttttcctgggacctggcaggtggacagcacctcaat
ggaattaatacactgggagaaaacattgctgataacggaggtattggtcaagcatacaga
gcctatcagaattatgttaaaaagaatggtgaagaaaaattacttcctggacttgaccta
aatcacaaacaactattcttcttgaactttgcacaggtctggtgtggaacctataggcca
gagtatgcagtcaactccattaaaacagatgtgcacagtccaggcaatttcaggattatt
gggactttgcagaactctgcagagttttcagaagcctttcactgccgcaagaattcctac
atgaatccagaaaagaaatgccgggtttggtga

DBGET integrated database retrieval system