KEGG   Macaca fascicularis (crab-eating macaque): 101926546
Entry
101926546         CDS       T02918                                 

Gene name
IL1A
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  interleukin 1 alpha
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04217  Necroptosis
mcf04218  Cellular senescence
mcf04380  Osteoclast differentiation
mcf04640  Hematopoietic cell lineage
mcf04932  Non-alcoholic fatty liver disease
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04940  Type I diabetes mellitus
mcf05010  Alzheimer disease
mcf05020  Prion disease
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05133  Pertussis
mcf05140  Leishmaniasis
mcf05152  Tuberculosis
mcf05162  Measles
mcf05164  Influenza A
mcf05321  Inflammatory bowel disease
mcf05323  Rheumatoid arthritis
mcf05332  Graft-versus-host disease
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101926546 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101926546 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101926546 (IL1A)
   04218 Cellular senescence
    101926546 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101926546 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101926546 (IL1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    101926546 (IL1A)
   05162 Measles
    101926546 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101926546 (IL1A)
   05152 Tuberculosis
    101926546 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101926546 (IL1A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101926546 (IL1A)
   05321 Inflammatory bowel disease
    101926546 (IL1A)
   05332 Graft-versus-host disease
    101926546 (IL1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101926546 (IL1A)
   05020 Prion disease
    101926546 (IL1A)
   05022 Pathways of neurodegeneration - multiple diseases
    101926546 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101926546 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101926546 (IL1A)
   04932 Non-alcoholic fatty liver disease
    101926546 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101926546 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    101926546 (IL1A)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Interleukins
   101926546 (IL1A)
SSDB
Motif
Pfam: IL1_propep IL1 DUF240
Other DBs
NCBI-GeneID: 101926546
NCBI-ProteinID: NP_001271109
UniProt: Q4R4F0
Position
13
AA seq 271 aa
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYDVSYGLLHEGCMDQSVSLSISEIS
KTSKLTFKQSMVVVSTNGKVLKKRRLSLSQSITDNNLEAIANDSEEEIIKPRSAPFSFLS
NMTYHFIRIIKHEFILNDTLNQTIIRANDQYLTAAAIHNLDEAVKFDMGAYTSSKDDTKV
PVILRISKTQLYVSAQDEDQPVLLKEMPEIPKTITGSETNFLFFWETHGTKNYFISVAHP
NLFIATKHDNWVCLAKGLPSITDFQILENQA
NT seq 816 nt   +upstreamnt  +downstreamnt
atggccaaagttccggacatgtttgaagacctgaagaactgttacagtgaaaatgaagaa
gacagttcctccattgaccatctgtctctgaatcagaaatccttctatgatgtaagctat
ggcctactccatgaaggctgcatggatcagtctgtgtccctgagtatctctgaaatctct
aaaacatccaagctgaccttcaagcagagcatggtggtagtatcaaccaatgggaaggtt
ctgaagaagagacggttgagtttaagccagtccatcactgataataacctggaggccatc
gccaacgactcagaggaagaaatcatcaagcccaggtcggcaccttttagcttcctaagc
aatatgacataccactttataaggatcatcaaacacgaattcatcctgaatgacaccctc
aatcaaactataattcgagccaatgatcagtacctcacggctgctgcaatacataatctg
gatgaagcagtgaaatttgacatgggtgcttatacgtcatcaaaggatgatactaaagtt
cctgtgattctaagaatctcgaaaactcaattgtatgtgagtgcccaagatgaagaccaa
ccggtgctgctgaaggagatgcctgagatacccaaaaccatcacaggtagtgagaccaac
ttcctcttcttctgggaaactcatggcactaagaactacttcatatcagttgcccatcca
aacttgtttattgccacaaagcatgacaattgggtgtgcttggcaaaggggctaccctct
atcactgactttcagatactggaaaaccaggcttag

KEGG   Macaca fascicularis (crab-eating macaque): 102119749
Entry
102119749         CDS       T02918                                 

Gene name
IL1B
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  interleukin 1 beta
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01523  Antifolate resistance
mcf04010  MAPK signaling pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04064  NF-kappa B signaling pathway
mcf04217  Necroptosis
mcf04380  Osteoclast differentiation
mcf04620  Toll-like receptor signaling pathway
mcf04621  NOD-like receptor signaling pathway
mcf04623  Cytosolic DNA-sensing pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04657  IL-17 signaling pathway
mcf04659  Th17 cell differentiation
mcf04668  TNF signaling pathway
mcf04750  Inflammatory mediator regulation of TRP channels
mcf04932  Non-alcoholic fatty liver disease
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04940  Type I diabetes mellitus
mcf05010  Alzheimer disease
mcf05020  Prion disease
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05132  Salmonella infection
mcf05133  Pertussis
mcf05134  Legionellosis
mcf05135  Yersinia infection
mcf05140  Leishmaniasis
mcf05142  Chagas disease
mcf05143  African trypanosomiasis
mcf05144  Malaria
mcf05146  Amoebiasis
mcf05152  Tuberculosis
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05168  Herpes simplex virus 1 infection
mcf05171  Coronavirus disease - COVID-19
mcf05321  Inflammatory bowel disease
mcf05323  Rheumatoid arthritis
mcf05332  Graft-versus-host disease
mcf05417  Lipid and atherosclerosis
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102119749 (IL1B)
   04064 NF-kappa B signaling pathway
    102119749 (IL1B)
   04668 TNF signaling pathway
    102119749 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102119749 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102119749 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102119749 (IL1B)
   04620 Toll-like receptor signaling pathway
    102119749 (IL1B)
   04621 NOD-like receptor signaling pathway
    102119749 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    102119749 (IL1B)
   04625 C-type lectin receptor signaling pathway
    102119749 (IL1B)
   04659 Th17 cell differentiation
    102119749 (IL1B)
   04657 IL-17 signaling pathway
    102119749 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102119749 (IL1B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102119749 (IL1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102119749 (IL1B)
   05164 Influenza A
    102119749 (IL1B)
   05162 Measles
    102119749 (IL1B)
   05168 Herpes simplex virus 1 infection
    102119749 (IL1B)
   05163 Human cytomegalovirus infection
    102119749 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102119749 (IL1B)
   05135 Yersinia infection
    102119749 (IL1B)
   05133 Pertussis
    102119749 (IL1B)
   05134 Legionellosis
    102119749 (IL1B)
   05152 Tuberculosis
    102119749 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102119749 (IL1B)
   05144 Malaria
    102119749 (IL1B)
   05140 Leishmaniasis
    102119749 (IL1B)
   05142 Chagas disease
    102119749 (IL1B)
   05143 African trypanosomiasis
    102119749 (IL1B)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102119749 (IL1B)
   05321 Inflammatory bowel disease
    102119749 (IL1B)
   05332 Graft-versus-host disease
    102119749 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102119749 (IL1B)
   05020 Prion disease
    102119749 (IL1B)
   05022 Pathways of neurodegeneration - multiple diseases
    102119749 (IL1B)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102119749 (IL1B)
   05418 Fluid shear stress and atherosclerosis
    102119749 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102119749 (IL1B)
   04932 Non-alcoholic fatty liver disease
    102119749 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102119749 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102119749 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102119749 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    102119749 (IL1B)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Interleukins
   102119749 (IL1B)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Heparan sulfate / Heparin
  Cytokines
   102119749 (IL1B)
SSDB
Motif
Pfam: IL1 IL1_propep Inhibitor_I71
Other DBs
NCBI-GeneID: 102119749
NCBI-ProteinID: XP_005575341
Position
13
AA seq 268 aa
MAEVPELASEMMAYYSGNEDDLFFDVDGPKQMKCSFQDLDLCPLDGGIQLQISHEHYNEG
FRQAVSVVVAMEKLRKMLVPCPQIFQDNDLSTLIPFIFEEEPVFLDTRNNDACVHDAPVR
SLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKA
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTRGGQDITDFTMQFVS
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcagaagtacctgaactcgccagtgaaatgatggcttactacagcggcaacgaggat
gacttgttctttgacgtcgatggccctaaacagatgaagtgctccttccaggatctagac
ctctgccctctggatggcggcatccagctacaaatctcccacgagcactacaacgagggc
ttccggcaggccgtgtcggttgttgtagccatggagaagctaaggaagatgctggttccc
tgcccacagatcttccaggacaatgacctgagcaccttgattcccttcatctttgaagaa
gaacctgtcttcctcgacacacgcaataacgacgcttgtgtgcatgatgcacctgtacga
tcactgcactgcacactccgggatgcacagctcaaaagcttggtgatgtctggtccatat
gaactgaaagctctccacctccagggacaggatctggagcaacaagtggtgttctccatg
tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggca
aagaatctgtacctgtcctgtgtgttgaaagatgataagcccacactacagctggagagt
gtagatcccaaaaactacccaaagaagaagatggaaaagcgatttgtcttcaacaagata
gaaatcaataacaagctggaattcgagtctgcccaattccccaactggtacatcagcacc
tctcaagcggaaaacatgcccgtcttcctgggagggaccagaggtggccaggatataact
gacttcaccatgcaatttgtgtcttga

DBGET integrated database retrieval system