KEGG   Macaca fascicularis (crab-eating macaque): 101926559
Entry
101926559         CDS       T02918                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin A1
  KO
K06627  cyclin-A
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04110  Cell cycle
mcf04152  AMPK signaling pathway
mcf04218  Cellular senescence
mcf04914  Progesterone-mediated oocyte maturation
mcf05161  Hepatitis B
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05203  Viral carcinogenesis
mcf05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101926559 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101926559 (CCNA1)
   04218 Cellular senescence
    101926559 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101926559 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101926559 (CCNA1)
   05202 Transcriptional misregulation in cancer
    101926559 (CCNA1)
   05203 Viral carcinogenesis
    101926559 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101926559 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101926559 (CCNA1)
   05161 Hepatitis B
    101926559 (CCNA1)
   05169 Epstein-Barr virus infection
    101926559 (CCNA1)
   05165 Human papillomavirus infection
    101926559 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcf03032]
    101926559 (CCNA1)
   03036 Chromosome and associated proteins [BR:mcf03036]
    101926559 (CCNA1)
DNA replication proteins [BR:mcf03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101926559 (CCNA1)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101926559 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2 DUF155
Other DBs
NCBI-GeneID: 101926559
NCBI-ProteinID: NP_001271573
UniProt: Q4R337
Position
17
AA seq 421 aa
MHCSNPKNGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTENGQYRRTCGQGITRI
RCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDGDSCSGREGMAFEDVYEV
DTSTLKSDLHFLLDFNTVSPMLVDSSLLSQSEEISSLGTDVTNVTEYAEEIYQYLREAEI
RHRPKAHYMKKQPDITEGMRMILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFW
PETLAAFTGYSLSEIVPCLSELHKVYLDIPHRPQQAIREKYKASKYLRVSLMEPPSVLLL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcactgcagcaaccccaagaatggagttgtgctggctacagtggcccgaggtcccgat
gcttgtcagatactcaccagagccccgctgggccaggatcccccgcagaggacagtgcta
gggctgctaactgaaaatggacagtacaggaggacctgtggccaggggatcacaagaatc
aggtgttattctggatcagaaaatgccttccctccagctggaaagaaagcgctccctgac
tgtggggtccaagagccccccaagcaagggttcgacatctacatggatgaactagagcag
ggggacggagacagctgttcgggcagagaggggatggcgtttgaggatgtgtatgaagta
gacaccagcacactcaagtcagacctgcacttcctgctggatttcaacacagtttctcct
atgctggtagattcatctctgctctcccagtctgaagagatatccagtcttggcacagat
gtgacaaatgtgactgaatatgctgaagaaatttatcagtaccttagagaagctgaaata
aggcacagacccaaagcacactacatgaagaagcagccggacatcacggaaggcatgcgc
atgattctggtggactggctggtggaggttggggaagaatataagcttcgagcggagacc
ctgtatctggctgtcaacttcctggacaggttcctttcatgtatgtctgttctgagaggg
aaattgcagctcgtgggaacagcagctattcttttggcttcgaaatatgaagagatatat
cctcctgaagtagacgagtttgtctatatcactgatgatacatacacaaaacgacaactg
ttaaaaatggaacacttgcttctgaaagttctagcttttgatctgacagtgccaaccacc
aaccaatttctccttcagtacctgaggcgacaaggagtgtgcgtcaggactgagaacctg
gctaagtatgtagcagagctgagtctacttgaagcagacccattcttgaaatatcttcct
tcattgatagctgcagcagctttttgcctggcaaactacactgtgaacaagcacttttgg
ccggaaacccttgctgcatttacagggtattcattaagtgaaattgtaccttgcctgagt
gagcttcataaagtgtaccttgatataccccatcgacctcagcaggcaattagggagaag
tacaaggcttcaaagtacctgcgtgtgtccctcatggagccaccttcagttcttcttcta
cagtaa

KEGG   Macaca fascicularis (crab-eating macaque): 102122434
Entry
102122434         CDS       T02918                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin A2
  KO
K06627  cyclin-A
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04110  Cell cycle
mcf04152  AMPK signaling pathway
mcf04218  Cellular senescence
mcf04914  Progesterone-mediated oocyte maturation
mcf05161  Hepatitis B
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05203  Viral carcinogenesis
mcf05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102122434 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102122434 (CCNA2)
   04218 Cellular senescence
    102122434 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102122434 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102122434 (CCNA2)
   05202 Transcriptional misregulation in cancer
    102122434 (CCNA2)
   05203 Viral carcinogenesis
    102122434 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102122434 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102122434 (CCNA2)
   05161 Hepatitis B
    102122434 (CCNA2)
   05169 Epstein-Barr virus infection
    102122434 (CCNA2)
   05165 Human papillomavirus infection
    102122434 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcf03032]
    102122434 (CCNA2)
   03036 Chromosome and associated proteins [BR:mcf03036]
    102122434 (CCNA2)
DNA replication proteins [BR:mcf03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102122434 (CCNA2)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102122434 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 102122434
NCBI-ProteinID: XP_005555896
UniProt: A0A2K5WIK0 G7P675
Position
5
AA seq 432 aa
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKAGNPRG
LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKETQKKPAESQKT
EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANSKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgttgggcaactccgcgccggggcctgcgacccgcgaggcgggctcagccctactagca
ttgcagcagactgcgctccaagaggaccaggagaatatcaacccggaaaaggcagcgccc
gtccagcaaccgcggacccgggccgcgctggcggtactgaaggccgggaacccgcggggt
ctagcgcagcagcagaggccgaagacgcgacgggttgcaccccttaaggatcttcctgta
aatgatgagcatgtcaccgttcctccttggaaagcaaacagtaaacagcctgcgttcacc
attcatgtggatgaagcagaaaaagagactcagaagaagccagctgaatctcaaaaaacg
gagcgtgaagatgccctggcttttaattcagccattagtttacctggacccagaaaacca
ttggtccctcttgattatccaatggatggtagttttgagtcaccacatactatggacatg
tcaattgtattagaagatgaaaagccagtgagtgttaatgaagtaccagactaccatgag
gatattcacacataccttagggaaatggaggttaaatgtaaacctaaagtgggttacatg
aagaaacagccagacatcactaacagtatgagagctatcctcgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaactacattgat
aggttcctttcttccatgtcagtgctgagaggaaagcttcagcttgtgggcactgctgct
atgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtgtac
attacagatgatacctacaccaagaaacaagttctgagaatggagcatctagttttgaaa
gtccttacttttgacttagctgctccaacagtaaatcagtttcttacccaatactttctg
catcagcagcctgcaaacagcaaagttgaaagtttagcaatgtttttgggagaattaagt
ttgatagatgctgacccatacctaaagtatttgccatcagttattgctggagccgccttt
catttagcactctacacagtcacaggacaaagctggcctgaatcattaatacgaaagact
ggatataccctggaaagtcttaagccttgtctcatggaccttcaccagacctacctcaaa
gctccacagcatgcacaacagtcaataagagaaaagtacaaaaattcaaagtatcatggt
gtttctctcctcaacccaccagagacactaaatctgtaa

KEGG   Macaca fascicularis (crab-eating macaque): 102137714
Entry
102137714         CDS       T02918                                 

Gene name
CCNE1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04110  Cell cycle
mcf04114  Oocyte meiosis
mcf04115  p53 signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04218  Cellular senescence
mcf04934  Cushing syndrome
mcf05161  Hepatitis B
mcf05162  Measles
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05206  MicroRNAs in cancer
mcf05215  Prostate cancer
mcf05222  Small cell lung cancer
mcf05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102137714 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102137714 (CCNE1)
   04114 Oocyte meiosis
    102137714 (CCNE1)
   04115 p53 signaling pathway
    102137714 (CCNE1)
   04218 Cellular senescence
    102137714 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102137714 (CCNE1)
   05206 MicroRNAs in cancer
    102137714 (CCNE1)
   05203 Viral carcinogenesis
    102137714 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102137714 (CCNE1)
   05215 Prostate cancer
    102137714 (CCNE1)
   05222 Small cell lung cancer
    102137714 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102137714 (CCNE1)
   05161 Hepatitis B
    102137714 (CCNE1)
   05162 Measles
    102137714 (CCNE1)
   05169 Epstein-Barr virus infection
    102137714 (CCNE1)
   05165 Human papillomavirus infection
    102137714 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102137714 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcf03032]
    102137714 (CCNE1)
   03036 Chromosome and associated proteins [BR:mcf03036]
    102137714 (CCNE1)
DNA replication proteins [BR:mcf03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102137714 (CCNE1)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102137714 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102137714
NCBI-ProteinID: XP_005588757
UniProt: A0A2K5WVC6
Position
19
AA seq 410 aa
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVAVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNTGCADPCSLIPTPDKEDDERVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELTQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSSKKQSSEPEMA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagcgcagggagcgggatgcgaaggagcgggacaccatgaaggaggacggc
ggcgcagagttctcggctcgctccaggaagaggaaggcaaacgtggccgtttttttgcag
gatccagatgaagaaatggccaaaatcgacaggacggcgagggaccagtgtgggagccag
ccttgggacaataatacaggctgtgcagacccctgctccctgatccccacacctgacaaa
gaagatgatgagcgggtttacccaaactcaacgtgcaagcctcggattattgcaccatcc
agaggctccccgctgcctgtactgagctgggcaaatagagaggaagtctggaaaatcatg
ttaaacaaggaaaagacatacttaagggatcagcactttcttgagcaacaccctcttctg
cagccaaaaatgcgagcaattcttctggattggttaatggaggtgtgtgaagtctataaa
cttcatagggagaccttttacttggcacaggatttctttgaccggtatatggcgacacaa
gaaaatgttgtgaaaactcttttacagcttattgggatttcatctttatttattgcagcc
aaacttgaggaaatctatcctccaaagttgcaccagtttgcgtatgtgacagatggagct
tgttcaggagatgaaattctcaccatggaattaatgattatgaaggcccttaagtggcgt
ttaagtcccctgactattgtgtcctggctgaatgtatacatgcaggttgcatatctaaat
gacttacatgaagtgctactgccgcagtatccccagcaaatctttatacagattgcagag
ctgttggatctctgtgtcctggatgttgactgcctcgaatttccttatggtatacttgct
gcttcagccttgtatcatttctcttcatctgaattgacgcaaaaggtttcagggtatcag
tggtgcgacatagagaactgtgtcaagtggatggttccatttgccatggtaataagggag
acggggagctcaaaactgaagcacttcaggggcgttgctgatgaagatgcacacaacata
cagacccacagagacagcttggacttgctggacaaagcccgagcaaagaaagccatgttg
tctgaacaaaatagggcttctcctctccccagtgggctcctcacccctccacagagcagt
aagaagcagagcagcgagccagaaatggcgtga

KEGG   Macaca fascicularis (crab-eating macaque): 102138564
Entry
102138564         CDS       T02918                                 

Gene name
CCNE2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04110  Cell cycle
mcf04114  Oocyte meiosis
mcf04115  p53 signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04218  Cellular senescence
mcf04934  Cushing syndrome
mcf05161  Hepatitis B
mcf05162  Measles
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05206  MicroRNAs in cancer
mcf05215  Prostate cancer
mcf05222  Small cell lung cancer
mcf05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102138564 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102138564 (CCNE2)
   04114 Oocyte meiosis
    102138564 (CCNE2)
   04115 p53 signaling pathway
    102138564 (CCNE2)
   04218 Cellular senescence
    102138564 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102138564 (CCNE2)
   05206 MicroRNAs in cancer
    102138564 (CCNE2)
   05203 Viral carcinogenesis
    102138564 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    102138564 (CCNE2)
   05215 Prostate cancer
    102138564 (CCNE2)
   05222 Small cell lung cancer
    102138564 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102138564 (CCNE2)
   05161 Hepatitis B
    102138564 (CCNE2)
   05162 Measles
    102138564 (CCNE2)
   05169 Epstein-Barr virus infection
    102138564 (CCNE2)
   05165 Human papillomavirus infection
    102138564 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102138564 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcf03032]
    102138564 (CCNE2)
   03036 Chromosome and associated proteins [BR:mcf03036]
    102138564 (CCNE2)
DNA replication proteins [BR:mcf03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102138564 (CCNE2)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102138564 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102138564
NCBI-ProteinID: XP_005563782
Position
8
AA seq 426 aa
MSRRSSRLQAKQQPQPSQTESPQEVQIIQAKKRKTTQDVKKRREEVTKKHQYEIRRSAGR
RLSLGGFYVPESYYSCRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFIN
PSPLPDLSWGCSKEVWLNMLKKESRYVHEKHLEVLHSDLEPQMRSILLDWLLEVCEVYTL
HRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGAC
SEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQL
LDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKST
SPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTE
KPPGKH
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgtcaagacgaagtagccgtttacaagctaagcagcagccccagcccagccagacggag
tcaccccaagaagtccagataatccaggccaagaagaggaaaacaacccaggatgtcaaa
aaaagaagagaggaggtcaccaagaaacatcagtatgaaattaggaggtcagcaggaagg
cgcttatctttgggtggtttctatgtgcccgaatcctactacagctgcagaaattgttgg
ccacctgtattatctggggggatcagtccttgcattatcattgaaacacctcacaaagaa
ataggaacaagtgatttctccagatttacaaattacagatttaaaaatctttttattaat
ccttcacctttgcctgatttaagctggggatgttcaaaagaagtctggctaaacatgtta
aaaaaggagagcagatatgttcatgaaaaacatcttgaagttctgcattctgacttggaa
ccacagatgaggtccatacttctagactggcttttagaggtatgtgaagtatacacactt
catagggaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaag
gatataaataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaa
cttgaggaaatctacgctcctaaactccaagagtttgcttacgtcactgatggtgcttgc
agtgaagaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactt
tgtcctgtaacaatcatctcctggctaaatctctttctccaagttgatgctcttaaagat
gctcctaaagttcttctacctcagtattctcaggaaacattcattcaaatagctcagctt
ttagatctgtgtattctagccattgattcattagagttccagtacagaatactgactgct
gctgccctgtgccattttacctccattgaagtggttaagaaagcctcaggtttggagtgg
gacagtatttcagaatgtgtagattggatggtaccttttgtcaatgtagtaaaaagtact
agtccagtgaagctgaagacttttaagaagattcctatggaagacagacataatatccag
acacatacaaattatttggctatgctggaagaagtaaattacataaacaccttcagaaaa
gggggacagttgtcaccagtgtgcaatggaggcatcatgacaccaccgaagagcaccgaa
aaaccaccaggaaaacactaa

DBGET integrated database retrieval system