KEGG   Macaca fascicularis (crab-eating macaque): 101926577
Entry
101926577         CDS       T02918                                 

Gene name
CD36
Definition
(RefSeq) CD36 molecule
  KO
K06259  CD36 antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf03320  PPAR signaling pathway
mcf04145  Phagosome
mcf04152  AMPK signaling pathway
mcf04512  ECM-receptor interaction
mcf04640  Hematopoietic cell lineage
mcf04920  Adipocytokine signaling pathway
mcf04931  Insulin resistance
mcf04975  Fat digestion and absorption
mcf04979  Cholesterol metabolism
mcf05144  Malaria
mcf05415  Diabetic cardiomyopathy
mcf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101926577 (CD36)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101926577 (CD36)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101926577 (CD36)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101926577 (CD36)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101926577 (CD36)
   03320 PPAR signaling pathway
    101926577 (CD36)
  09154 Digestive system
   04975 Fat digestion and absorption
    101926577 (CD36)
   04979 Cholesterol metabolism
    101926577 (CD36)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101926577 (CD36)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101926577 (CD36)
   05415 Diabetic cardiomyopathy
    101926577 (CD36)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101926577 (CD36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcf04131]
    101926577 (CD36)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    101926577 (CD36)
   04090 CD molecules [BR:mcf04090]
    101926577 (CD36)
Membrane trafficking [BR:mcf04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    101926577 (CD36)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101926577 (CD36)
CD molecules [BR:mcf04090]
 Proteins
  101926577 (CD36)
SSDB
Motif
Pfam: CD36
Other DBs
NCBI-GeneID: 101926577
NCBI-ProteinID: XP_005550429
UniProt: Q4R6B4 G7P1X2
Position
3
AA seq 472 aa
MGCDRNCGLITGAVIGAVLAVFGGILMPVGDMLIQKTIKKEVVLEEGTIAFKNWVKTGTE
IYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENITQDPKDNTVSFLQPNGA
IFEPSLSVGTEADNFTVLNLAVAAASHIYPNPFVQVVLNSLINKSKSSMFQVRTLRELLW
GYTDPFLSLVPYPVSTRVGMFYPYNNTADGVYKVFNGKDSISKVAIIDTYKGKRNLSYWE
SYCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAF
ASPVQNPDNHCFCTEKIISKNCTSYGVLDISKCKEGKPVYISLPHFLYASPDVSETIDGL
NPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSNKIQVLKRLKRNYIVPILWLNETG
TIGDEKAKMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgggctgtgaccgcaactgtggactcatcactggggctgtcattggtgccgtcctggct
gtgtttggaggtattctaatgccagttggagacatgcttatccagaagacaattaaaaag
gaagttgtccttgaagaaggtacaattgcttttaaaaattgggttaaaacaggcacagaa
atttacagacagttttggatctttgatgtgcaaaatccacaggaagtgatgatgaacagc
agcaacattcaagttaagcaaagaggtccttatacgtacagagttcgttttctagccaag
gaaaatataacccaggaccctaaggacaacacagtctctttcctacagcccaatggtgcc
atctttgaaccttcactatcagttggaacagaagctgacaacttcacagttctcaatctg
gctgtggcagctgcatcccatatctatccaaatccatttgttcaagtggtactcaattcg
cttattaacaagtcaaaatcttctatgttccaagtcagaactttgagagaactgttatgg
ggctatacggatccatttttgagtttggttccataccctgtttctactagagttggtatg
ttttatccttacaacaatactgcggatggagtttataaagttttcaatggaaaagacagc
ataagtaaagttgccataatcgacacctataaaggtaaaaggaatctctcctattgggaa
agttattgtgacatgattaatggtacagatgcagcctcgtttccaccttttgttgagaag
agccaggtattgcagttcttttcttccgacatttgcaggtcaatctatgctgtatttgaa
tccgacgttaatctgaaaggaattcctgtgtatagatttgttcttccatccaaggccttt
gcctctccagttcaaaacccagacaaccattgtttctgcacagaaaaaattatctcaaaa
aattgtacatcatatggtgtgctagacatcagcaaatgcaaagaagggaaacctgtgtac
atttcacttcctcattttctatatgcaagtcctgacgtttcagaaactattgatggatta
aacccaaatgaagaagaacataggacatacttggatattgaacctataactggattcact
ttacaatttgcaaaacggctgcaggtcaacctattggtcaagccatcaaacaaaattcaa
gtattaaagcgtctgaagaggaactatattgtgcctattctttggcttaatgagactggg
accattggtgatgagaaggcaaagatgttcagaagtcaagtaactggaaaaataaacctc
cttggcctgatagaaatgatcttactcagtgttggtgtggtgatgtttgttgcttttatg
atttcgtattgtgcatgcagatcaaaaacaataaaataa

DBGET integrated database retrieval system