KEGG   Macaca fascicularis (crab-eating macaque): 102114865
Entry
102114865         CDS       T02918                                 

Gene name
Mafa-A, Mafa-A1, Mafa-AG, Mafa-AG2, Mafa-AG3
Definition
(RefSeq) HLA class I histocompatibility antigen, A-11 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102114865 (Mafa-A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102114865 (Mafa-A)
   04145 Phagosome
    102114865 (Mafa-A)
  09143 Cell growth and death
   04218 Cellular senescence
    102114865 (Mafa-A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102114865 (Mafa-A)
   04612 Antigen processing and presentation
    102114865 (Mafa-A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102114865 (Mafa-A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102114865 (Mafa-A)
   05170 Human immunodeficiency virus 1 infection
    102114865 (Mafa-A)
   05168 Herpes simplex virus 1 infection
    102114865 (Mafa-A)
   05163 Human cytomegalovirus infection
    102114865 (Mafa-A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102114865 (Mafa-A)
   05169 Epstein-Barr virus infection
    102114865 (Mafa-A)
   05165 Human papillomavirus infection
    102114865 (Mafa-A)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102114865 (Mafa-A)
   05330 Allograft rejection
    102114865 (Mafa-A)
   05332 Graft-versus-host disease
    102114865 (Mafa-A)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102114865 (Mafa-A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102114865 (Mafa-A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102114865 (Mafa-A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102114865 (Mafa-A)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102114865 (Mafa-A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102114865 (Mafa-A)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 102114865
NCBI-ProteinID: NP_001306392
UniProt: E0WKX8
Position
4
AA seq 339 aa
MAVMAPRTLLLVLSGVLALTQTRAGSHSLRYFYTSMSRPGRWEPRFIAVGYVDDTQFVRF
DSDAESPRMEPRAPWVEQEGPEYWDRETQNMKTATQTYRVNLRTLLRYYNQSQGGSHTIQ
KMYGCDLGPDGRLLRGHEQFAYDGRDYIALNEDLRSWTAADMAAQNTQRKWEAEDVAEQH
RTYLEGECLESLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAGITLT
WQRDGEEQTQDTELVETRPTGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQSTIPIVGIIAGLVLLGTVVTGAVVAAVMWRRKSSDR
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcggtcatggcgccccgaaccctcctcctggtgctctcaggggtcctggccctgacc
cagacccgggcgggctctcactccttgaggtatttctacacctccatgtcccggcccggc
cgctgggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgagagtccgaggatggagccgcgggcaccgtgggtggagcaggagggt
ccagagtattgggaccgggagacacagaacatgaagaccgcgacacagacctaccgagtg
aacctgcggaccctgctccgctactacaaccagagccagggcgggtctcacaccatccag
aagatgtacggctgcgacctggggcccgacgggcgcctcctccgcgggcatgaacagttc
gcctacgatggcagggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacatggcggctcagaacacccagcgcaagtgggaggcagaggatgtggcggagcagcac
agaacctacctggagggcgagtgcctggagtcgctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcggacccccccaagacacatgtgacccaccaccctgtctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggggatcacactgacc
tggcagcgggatggagaggaacaaactcaggacacggagctcgtggagaccaggcctaca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggagaggagcagaga
tacacctgtcatgtgcaacatgagggtctgcccaagcccctcaccttgagatgggagccg
tcttcccagtccaccatccccatcgtgggcatcattgctggcctggttctgcttggaact
gtggtcactggagcggtggttgctgctgtgatgtggaggaggaagagctcagatagataa

KEGG   Macaca fascicularis (crab-eating macaque): 102116897
Entry
102116897         CDS       T02918                                 

Gene name
Mafa, Mafa-B, Mafa-I
Definition
(RefSeq) HLA class I histocompatibility antigen, B-7 alpha chain
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102116897 (Mafa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102116897 (Mafa)
   04145 Phagosome
    102116897 (Mafa)
  09143 Cell growth and death
   04218 Cellular senescence
    102116897 (Mafa)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102116897 (Mafa)
   04612 Antigen processing and presentation
    102116897 (Mafa)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102116897 (Mafa)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102116897 (Mafa)
   05170 Human immunodeficiency virus 1 infection
    102116897 (Mafa)
   05168 Herpes simplex virus 1 infection
    102116897 (Mafa)
   05163 Human cytomegalovirus infection
    102116897 (Mafa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102116897 (Mafa)
   05169 Epstein-Barr virus infection
    102116897 (Mafa)
   05165 Human papillomavirus infection
    102116897 (Mafa)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102116897 (Mafa)
   05330 Allograft rejection
    102116897 (Mafa)
   05332 Graft-versus-host disease
    102116897 (Mafa)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102116897 (Mafa)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102116897 (Mafa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102116897 (Mafa)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102116897 (Mafa)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102116897 (Mafa)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102116897 (Mafa)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 102116897
NCBI-ProteinID: NP_001306393
UniProt: A0A0S4XLK3
Position
Un
AA seq 362 aa
MRVMAPGTLLLLLSGALALTETWAGSHSLRYFGTTVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAESPRMEPRAPWMEQEGPEYWEEETRIAKARAQTERGNLRTALRYYNQSEAGSHTLQ
KMCGCDLGPDGRLLRGYYQSAYDGRDYIALNEDLRSWTAAGEAAQNTQRKWEAAGEAEQR
RAYLEGRCVEWLRRYLEKGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEEQTQDTELVETRPGGDGNFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQSTIPIMGIVAGLAVLAVVVTGAVVAAVMWRRKSSGGKGGSYSQAASSNSAQGSDVSL
TA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgcccggaaccctcctcctgctgctctcgggggccctggccctgacc
gagacctgggccggctcgcactccttgaggtatttcggcaccacagtgtcccggcccggc
cgcggggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgagagtccgaggatggagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggaagaggagacacggatcgccaaggcccgcgcacagactgagcgaggg
aacctgcggaccgcgctccgctactacaaccagagcgaggcggggtctcacaccctccag
aagatgtgtggctgcgacctggggccagacgggcgcctcctccgcgggtattaccagtcc
gcctacgacggcagggattacatcgccctgaacgaggacctgcgctcctggaccgctgcg
ggtgaggcggctcagaacacccagcgcaagtgggaggcggccggtgaggcagagcagcgg
agagcctacctggagggccggtgcgtggagtggctccgcagatacctggagaaggggaag
gagacgctgcagcgcgcggatcccccaaagacacacgtgacccaccaccccgtctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggagcaaactcaggacaccgagctcgtggagaccaggccagga
ggagatggaaacttccagaagtgggcagctgtggtggtgccttctggagaagagcagaga
tacacgtgccatgtgcagcatgaggggctgccggagcccctcaccctgagatgggagcca
tcttcccagtccaccatccccatcatgggcattgttgctggcctggctgtcctagcagtt
gtggtcaccggagctgtggtcgcagctgtgatgtggaggaggaagagctcaggtggaaaa
ggagggagctactctcaggctgcgtccagcaacagtgcccagggctctgatgtgtctctc
acagcttga

KEGG   Macaca fascicularis (crab-eating macaque): 102117143
Entry
102117143         CDS       T02918                                 

Gene name
Mafa-A, Mafa-A1, Mafa-A2, Mafa-A3, Mamu-A2
Definition
(RefSeq) HLA class I histocompatibility antigen, A-25 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102117143 (Mafa-A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102117143 (Mafa-A)
   04145 Phagosome
    102117143 (Mafa-A)
  09143 Cell growth and death
   04218 Cellular senescence
    102117143 (Mafa-A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102117143 (Mafa-A)
   04612 Antigen processing and presentation
    102117143 (Mafa-A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102117143 (Mafa-A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102117143 (Mafa-A)
   05170 Human immunodeficiency virus 1 infection
    102117143 (Mafa-A)
   05168 Herpes simplex virus 1 infection
    102117143 (Mafa-A)
   05163 Human cytomegalovirus infection
    102117143 (Mafa-A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102117143 (Mafa-A)
   05169 Epstein-Barr virus infection
    102117143 (Mafa-A)
   05165 Human papillomavirus infection
    102117143 (Mafa-A)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102117143 (Mafa-A)
   05330 Allograft rejection
    102117143 (Mafa-A)
   05332 Graft-versus-host disease
    102117143 (Mafa-A)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102117143 (Mafa-A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102117143 (Mafa-A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102117143 (Mafa-A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102117143 (Mafa-A)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102117143 (Mafa-A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102117143 (Mafa-A)
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 102117143
NCBI-ProteinID: NP_001270157
UniProt: G8A3X5
Position
4
AA seq 365 aa
MAVMAPRTLLLVLSGALALTQTWAGSHSLRYFYTSMSRPGRGQPRFISVGYVDDTQFVRF
DSDAESPREEPRAPWMEQEGPEYWDRETRICKADTQTLRENLRTLLRYYNQSEAGSHTIQ
TMYGCDLGPDGRLLRGYDQSAYDGRDYIALNEDLRSWTAADMAAQNTQRKWEAAGVAEQW
RAYLEGECLEWLRRHLENGKETLQRADSPKTHVTRHPISDYEATLRCWALGFYPAEITLT
WRRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGKEQRYTCHVQHEGLPEPLTLRWEP
SSQSTIPIVGIIAGLVLLGTVVTGALVAAVMWRKKSSDRKGGSYSQAASSDSAQGSDVSL
TACKV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcggtcatggcgccccgaaccctcctcctggtgctctccggggccctggccctgacc
cagacctgggcgggctcgcactccttgagatatttctacacctccatgtcccggcccggc
cgcgggcagccccgcttcatctccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgagagtccgagagaggagccgcgggcgccgtggatggagcaggagggt
ccggagtattgggaccgggagacacggatctgcaaggccgacacacagactctccgagag
aacctgcggaccctgctccgctactacaaccagagcgaggccgggtctcacaccatccag
acgatgtacggctgcgacctggggccggacgggcgcctcctccgcgggtatgaccagtcc
gcctacgacggcagggattacatcgccctgaacgaggacctgcgctcctggaccgcggcg
gacatggcggctcagaacacccagcggaagtgggaggcggcgggtgtggcggagcagtgg
agagcctacctggagggcgagtgcctggagtggctccgcagacacctggagaacgggaag
gagacgctgcagcgcgcggactcccccaagacacatgtaacccgccaccccatctctgac
tacgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcggcgggatggggaggaccaaactcaggacacggagctcgtggagaccaggcctgca
ggagatggaaccttccagaagtgggcggctgtggtggtgccttctggaaaggagcagaga
tacacctgtcatgtgcagcatgagggtctgcccgagcccctcaccctgagatgggagccg
tcttcccagtctaccatccccatcgtgggcatcattgctggcctggttctccttggaact
gtggtcactggagctctggtcgctgctgtgatgtggaggaagaagagctcagatagaaaa
ggaggaagctactctcaggctgcaagcagtgacagtgcccagggatctgatgtgtctctt
acggcttgtaaagtgtga

KEGG   Macaca fascicularis (crab-eating macaque): 102120132
Entry
102120132         CDS       T02918                                 

Gene name
Mafa, Mafa-B, Mafa-I
Definition
(RefSeq) HLA class I histocompatibility antigen, B-27 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102120132 (Mafa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102120132 (Mafa)
   04145 Phagosome
    102120132 (Mafa)
  09143 Cell growth and death
   04218 Cellular senescence
    102120132 (Mafa)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102120132 (Mafa)
   04612 Antigen processing and presentation
    102120132 (Mafa)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102120132 (Mafa)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102120132 (Mafa)
   05170 Human immunodeficiency virus 1 infection
    102120132 (Mafa)
   05168 Herpes simplex virus 1 infection
    102120132 (Mafa)
   05163 Human cytomegalovirus infection
    102120132 (Mafa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102120132 (Mafa)
   05169 Epstein-Barr virus infection
    102120132 (Mafa)
   05165 Human papillomavirus infection
    102120132 (Mafa)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102120132 (Mafa)
   05330 Allograft rejection
    102120132 (Mafa)
   05332 Graft-versus-host disease
    102120132 (Mafa)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102120132 (Mafa)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102120132 (Mafa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102120132 (Mafa)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102120132 (Mafa)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102120132 (Mafa)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102120132 (Mafa)
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 102120132
NCBI-ProteinID: NP_001306397
UniProt: Q4W7C7
Position
Un
AA seq 362 aa
MRVMAPGTLLLLLSGALALTETWAGSHSLRYFGTTVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAESPRMEPRAPWMEQEGPEYWEEETRIAKARAQTERGNLWTALRYYNQSEGGSHTLQ
KMYGCDLGPDGRLLRGYYQRAYDGKDYIALNEDLHSWTAADLAAQNTQRKWEAAGVAEQR
RAYLEGRCLEWLRRYLENGKETLQRADPPKTHVTHHPVSDHETILRCWALDFYPAEITLT
WQRDGEDQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQSTIPIVGIVAGLAVLAVVVTGAVVAAVMWRRKSSGGKGGSYSQAASSDSAQGSDVSL
TA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgcccggaaccctcctcctgctgctctcgggggccctggccctgacc
gagacctgggccggctcgcactccttgaggtatttcggcaccacagtgtcccggcccggc
cgcggggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttt
gacagcgacgccgagagtccgaggatggagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggaagaggagacacggatcgccaaggcccgcgcacagactgagcgaggg
aacctgtggaccgcgctccgctactacaaccagagcgagggggggtctcacaccctccag
aagatgtacggctgcgacctgggaccggacgggcgcctcctccgcgggtattaccagcgc
gcctacgacggcaaggattacatcgccctgaacgaggacctgcactcctggaccgccgcg
gacttggcggctcagaacacccagcggaagtgggaggcggccggtgtggcagagcagcgg
agagcctacctggagggccggtgcctggagtggctccgcagatacctggagaacgggaag
gagacactgcagcgcgcggaccccccaaagacacacgtgacccaccaccctgtctctgac
catgagaccatcctgaggtgctgggccctggacttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccaaactcaggacactgagctcgtggagaccaggccagga
ggagatggaaccttccagaaatggggagctgtggtggtgccttctggagaagagcagaga
tacacgtgccatgtgcagcatgaggggctgccggagcccctcaccctgagatgggagcca
tcttcccagtccaccatccccatcgtgggcatcgttgctggcctggctgtcctagcagtt
gtggtcaccggagctgtggtcgctgctgtgatgtggaggaggaagagctcaggtggaaaa
ggagggagctactctcaggctgcgtccagcgacagtgcccagggctctgatgtgtctctc
acggcttga

KEGG   Macaca fascicularis (crab-eating macaque): 102121775
Entry
102121775         CDS       T02918                                 

Gene name
Mafa, Mafa-B
Definition
(RefSeq) class I histocompatibility antigen, Gogo-B*0103 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102121775 (Mafa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102121775 (Mafa)
   04145 Phagosome
    102121775 (Mafa)
  09143 Cell growth and death
   04218 Cellular senescence
    102121775 (Mafa)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102121775 (Mafa)
   04612 Antigen processing and presentation
    102121775 (Mafa)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102121775 (Mafa)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102121775 (Mafa)
   05170 Human immunodeficiency virus 1 infection
    102121775 (Mafa)
   05168 Herpes simplex virus 1 infection
    102121775 (Mafa)
   05163 Human cytomegalovirus infection
    102121775 (Mafa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102121775 (Mafa)
   05169 Epstein-Barr virus infection
    102121775 (Mafa)
   05165 Human papillomavirus infection
    102121775 (Mafa)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102121775 (Mafa)
   05330 Allograft rejection
    102121775 (Mafa)
   05332 Graft-versus-host disease
    102121775 (Mafa)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102121775 (Mafa)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102121775 (Mafa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102121775 (Mafa)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102121775 (Mafa)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102121775 (Mafa)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102121775 (Mafa)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 102121775
NCBI-ProteinID: NP_001306399
UniProt: A0A0S4XLA9
Position
Un
AA seq 361 aa
MQVMAPRTLLLLLSGALSLTETWAGSHSMRYFTTAVSRPGRREPWYLEVGYVDDTQFVRF
DSDVESPRMEPRAPWVEQEGPEYWDRNTRRAKGNAQTERGNLRTLLRYYNQSEGGSHTVQ
RMYGCDLGPDGRLLRGYHQSAYDGKDYIALNEDLRSWTAADMAARFTQRKWEAAREAEQM
RAYLEGECLEWLRRHLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQSTIPIMGIVAGLAVLAVVTGAVVAAMMCRRKTSGGKGGSYFQAASKDSPQGSDESLM
A
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgcaggtcatggcgccccgaaccctcctcctgctgctctcgggggccctgtccctgacc
gagacctgggccggctcgcactccatgaggtatttcaccaccgccgtgtcccggcccggc
cgccgggaaccctggtatctcgaagtcggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgtcgagagtccgaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccggaacacacggagagccaagggcaacgcacagactgagcgaggg
aacttgcggaccctgctccgctactacaaccagagcgagggggggtctcacacagtccag
aggatgtacggctgcgacctggggcccgacgggcgcctcctccgcgggtatcaccagtcc
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacatggcggctcggttcacccagcgcaagtgggaggcggcccgcgaggcagagcagatg
agagcctacctggagggcgagtgcctggagtggctccgcagacacctggagaacgggaag
gagacgctgcagcgcgcggatcccccaaagacacacgtgacccaccaccccgtctctgac
catgaggccaccctgaggtgctgggctctgggcttctaccctgcggagatcacgctgacc
tggcagcgggatggggaggatcaaactcaggacaccgaacttgtggagaccaggccagga
ggagatggaaccttccaaaagtggggagctgtggtggtgccttctggagaagagcagaga
tacacatgccacgtacagcacgagggattgccggagcccctcaccctgagatgggagcca
tcttcccagtccaccatccccatcatgggcattgttgctggcctggctgtcctagcagtt
gtcaccggagctgtggtcgctgctatgatgtgcaggaggaagacctcaggtggaaaagga
gggagctactttcaggctgcgtccaaggacagtccccagggctctgatgagtctctcatg
gcttga

KEGG   Macaca fascicularis (crab-eating macaque): 102122138
Entry
102122138         CDS       T02918                                 

Gene name
MAFA-F, Mafa-IF
Definition
(RefSeq) mamu class I histocompatibility antigen, alpha chain F
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102122138 (MAFA-F)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102122138 (MAFA-F)
   04145 Phagosome
    102122138 (MAFA-F)
  09143 Cell growth and death
   04218 Cellular senescence
    102122138 (MAFA-F)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102122138 (MAFA-F)
   04612 Antigen processing and presentation
    102122138 (MAFA-F)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102122138 (MAFA-F)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102122138 (MAFA-F)
   05170 Human immunodeficiency virus 1 infection
    102122138 (MAFA-F)
   05168 Herpes simplex virus 1 infection
    102122138 (MAFA-F)
   05163 Human cytomegalovirus infection
    102122138 (MAFA-F)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102122138 (MAFA-F)
   05169 Epstein-Barr virus infection
    102122138 (MAFA-F)
   05165 Human papillomavirus infection
    102122138 (MAFA-F)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102122138 (MAFA-F)
   05330 Allograft rejection
    102122138 (MAFA-F)
   05332 Graft-versus-host disease
    102122138 (MAFA-F)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102122138 (MAFA-F)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102122138 (MAFA-F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102122138 (MAFA-F)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102122138 (MAFA-F)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102122138 (MAFA-F)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102122138 (MAFA-F)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 MHC_I_3 ig
Other DBs
NCBI-GeneID: 102122138
NCBI-ProteinID: XP_005553745
UniProt: A0A2K5TNK5
Position
4
AA seq 348 aa
MAPRTLLLVLSGALALTETWAGSHSLRYFSTAVSRPGRREPQYRYIAVEYVDDTQFLRFD
SDAAIPRMEPRAPWVEQEGPQYWERTTGYAKANARTDRVALRKLLLRYNQSEAGSHTLQG
MNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVARITQRFYEAEEYAEEFR
TYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDREATLRCWALGFYPAEITLTW
QRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLLQPLTLRWESS
SQPTIPIVGIVAGLAVLAVVVTGAVVAAVMWRRKSSDRNRGSYSQPTM
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggcgccccgaaccctcctcctggtgctctcaggggccctggccctgaccgagacctgg
gcgggctcccactccttgcggtattttagcaccgctgtgtcgcggcccggccgcagggag
cctcagtacaggtacatcgcggtggagtacgtggacgacacgcagttcctgcggttcgac
agcgacgccgcgattccgaggatggagccgcgggcgccgtgggtggagcaagaggggccg
cagtattgggagcggaccacagggtacgccaaggccaacgcacggactgaccgagtggcc
ctgaggaagctgctcctccgctacaaccagagcgaggcagggtctcacaccctccaggga
atgaacggctgcgacatggggcccgacggacgtctcctccgcgggtatcaccagcacgcc
tacgacggcaaggattacatctccctgaacgaggacctgcgctcctggaccgccgcggac
acggtagctcggatcacccagcgcttctatgaggcagaggaatatgcagaggagttcagg
acctacctggagggcgagtgcctggagttgctccgcagatacctggagaacgggaaggag
acgctacagcgcgcagatcctccaaaggcacacgttgcccaccaccccatctctgaccgt
gaggccaccctgaggtgctgggccctgggcttctaccctgccgagatcacactgacctgg
cagcgggacggggaggaacagacccaggacacggagcttgtggagaccaggcctgcaggg
gatggaaccttccagaagtgggcagctgtggtggtgccttccggagaggagcagagatac
acgtgccatgtgcaacacgaagggctgctccagcccctcaccctgagatgggagtcgtct
tctcagcccaccatccccattgtgggcatcgttgctggcctggctgtcctagcagttgtg
gttactggagctgtggtcgctgctgtaatgtggaggagaaagagctcagatagaaacaga
gggagctactctcagcctacaatgtga

KEGG   Macaca fascicularis (crab-eating macaque): 102123548
Entry
102123548         CDS       T02918                                 

Gene name
Mafa-B, Mafa-B17
Definition
(RefSeq) HLA class I histocompatibility antigen, B-14 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102123548 (Mafa-B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102123548 (Mafa-B)
   04145 Phagosome
    102123548 (Mafa-B)
  09143 Cell growth and death
   04218 Cellular senescence
    102123548 (Mafa-B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102123548 (Mafa-B)
   04612 Antigen processing and presentation
    102123548 (Mafa-B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102123548 (Mafa-B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102123548 (Mafa-B)
   05170 Human immunodeficiency virus 1 infection
    102123548 (Mafa-B)
   05168 Herpes simplex virus 1 infection
    102123548 (Mafa-B)
   05163 Human cytomegalovirus infection
    102123548 (Mafa-B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102123548 (Mafa-B)
   05169 Epstein-Barr virus infection
    102123548 (Mafa-B)
   05165 Human papillomavirus infection
    102123548 (Mafa-B)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102123548 (Mafa-B)
   05330 Allograft rejection
    102123548 (Mafa-B)
   05332 Graft-versus-host disease
    102123548 (Mafa-B)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102123548 (Mafa-B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102123548 (Mafa-B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102123548 (Mafa-B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102123548 (Mafa-B)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102123548 (Mafa-B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102123548 (Mafa-B)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig QcrA_N
Other DBs
NCBI-GeneID: 102123548
NCBI-ProteinID: XP_005595961
UniProt: A0A2K5VRE3
Position
Un
AA seq 363 aa
MVPRTLLLLLSGALALTETWVGSHSLRYFSTAVSRPGRGEPWYLEVGYVDDTQFVRFDSD
AASPRMQPRAPWMEQEGPEYWDRNTRNAKVNAETFRGDLRNLLRYYNQSEAGSHTFQWMY
GCDLGPDGRLLRGYRQFAYDGRDYIALNEDLRSWTAADTTAQITQRKWEAARAAEKLRAY
LEGECLEWLRRYLENGKETLQHADPPKTHVAHHPVSDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHKGLLEPLTLRWEPSSQ
STIPIVGIVAGLAVLGAVVAAVMWKRKSLGHFLPTRGKRGSYSQAACSNSAQSSCVSLMD
SKG
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggtgccccgaaccctcctcctgctgctctcgggggccctggccctgaccgagacctgg
gtgggctcccactccttgaggtatttcagcaccgctgtctcccggcccggccgcggggag
ccctggtacctcgaagtcggctacgtggacgacacgcagttcgtgcggttcgacagcgac
gcggcgagtccgaggatgcagccgcgggcgccgtggatggagcaggaagggccggagtat
tgggaccggaacacacggaacgccaaggtcaacgcagagactttccgaggggacttgagg
aacctgctccgctactacaaccagagcgaggcagggtctcacaccttccagtggatgtat
ggctgcgaccttgggcccgacgggcgcctcctccgcgggtaccggcagttcgcctacgac
ggcagggattacatcgccctgaacgaggacctgcgctcctggaccgccgcagacacaacg
gctcagataacgcagcgcaagtgggaggcggcccgtgcggcggagaagctgagagcctac
ttggagggcgagtgcctggagtggctccgtagatacctggagaacgggaaggagacgctg
cagcacgcggatcccccaaagacacatgtggcccaccaccccgtctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgg
gatggggaggagcaaactcaggacactgagcttgtggagaccaggccagcaggggatgga
accttccagaagtgggcagctgtggtggtgccttctggagaagagcagagatacacgtgc
catgtgcagcacaaggggctgctggagcccctcaccttgagatgggagccgtcttcccaa
tccaccatccccatcgtgggcatcgttgctggcctggctgtcctaggagctgtggttgct
gctgtgatgtggaagaggaagagcttaggacattttcttcccacaaggggaaaaagaggg
agctactctcaggctgcatgtagcaacagtgcccagagctcctgtgtgtctctcatggat
tctaaaggctga

KEGG   Macaca fascicularis (crab-eating macaque): 102125623
Entry
102125623         CDS       T02918                                 

Gene name
Mafa, Mafa-A, Mafa-A3, Mafa-A4
Definition
(RefSeq) patr class I histocompatibility antigen, A-126 alpha chain
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102125623 (Mafa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102125623 (Mafa)
   04145 Phagosome
    102125623 (Mafa)
  09143 Cell growth and death
   04218 Cellular senescence
    102125623 (Mafa)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102125623 (Mafa)
   04612 Antigen processing and presentation
    102125623 (Mafa)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102125623 (Mafa)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102125623 (Mafa)
   05170 Human immunodeficiency virus 1 infection
    102125623 (Mafa)
   05168 Herpes simplex virus 1 infection
    102125623 (Mafa)
   05163 Human cytomegalovirus infection
    102125623 (Mafa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102125623 (Mafa)
   05169 Epstein-Barr virus infection
    102125623 (Mafa)
   05165 Human papillomavirus infection
    102125623 (Mafa)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102125623 (Mafa)
   05330 Allograft rejection
    102125623 (Mafa)
   05332 Graft-versus-host disease
    102125623 (Mafa)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102125623 (Mafa)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102125623 (Mafa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102125623 (Mafa)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102125623 (Mafa)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102125623 (Mafa)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102125623 (Mafa)
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set C2-set_2 ig
Other DBs
NCBI-GeneID: 102125623
NCBI-ProteinID: XP_005595199
Position
4
AA seq 442 aa
MDWGGPALGIPHLXAVSLLLTTCVESFFLDTHDATLVLTPIGCRXSRDANQRRRSPGSKV
PTHPPGLRFSADAKDGIMAPRTLLLVLSGALALTQTRAGSHSMRYFYTSMSRPGRGEPRF
IAVGYVDDTQFVRFDSDAASQRMEPRAPWVEQEGPEYWDRETRNMKTATQNAPVALRNLR
GYYNQSEVGSHTFQRMVGCDLGPDGRLLRGYEQYAYDGRDYIALNEDLRSWTAADVAAQN
TQRKWEAAGAAERMRAYLEGTCLEWLRRHLENGKETLQRADPPKTHVTHHPVSDHEATLR
CWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGKEQRYTCHVQ
HEGLPEPLTLRWEPSSQSTIPIVGIIAGLVLLGAVVTGAVVAAVMWRRKSSDRKGGSYSQ
AASSDSAQGSDVSLTACKVWDS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggattggggaggcccagcgttggggattccccatctcnncgcagtttctcttcttctc
acaacctgcgtcgagtccttcttcctggatactcacgacgcgaccctcgttctcactccc
attgggtgtcggntttctagagacgccaatcagcgtcgccgcagtcccggttctaaagtc
cccactcacccaccaggactcagattctccgcagacgccaaggatggcatcatggcgccc
cgaaccctcctcctggtgctctcaggggccctggctctgacccagacccgggcgggctcg
cactccatgaggtatttctacacctccatgtcccggcccggccgcggggagccccgcttc
atcgccgtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagc
cagaggatggagccgcgggcgccgtgggtggagcaggagggtccggagtattgggaccgg
gagacacggaacatgaagaccgcgacacagaatgccccagtggccctgcggaacctgcgc
ggctactacaaccagagcgaggtcgggtctcacaccttccagaggatggttggctgcgac
ctgggacccgacgggcgcctcctccgcgggtatgaacagtacgcctacgacggcagggat
tacatcgccctgaacgaggacctgcgctcctggaccgcggcggatgtggcggctcagaac
acccagcggaagtgggaggcggcgggtgcggcggagaggatgagagcctacctggagggg
acgtgcctggagtggctccgcagacacctggagaacgggaaggagacgctgcagcgcgcg
gacccccccaagacacacgtgacccaccaccccgtctctgaccatgaggccaccctgagg
tgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgggatggggag
gaccaaactcaggacacggagctcgtggagaccaggcctgcaggagatggaaccttccag
aagtgggcggctgtggtggtgccttctggaaaggagcagagatacacctgtcatgtgcag
catgagggtctgcccgagcccctcaccctgagatgggagccgtcttcccagtctaccatc
cccatcgtgggcatcattgctggcctggttctccttggagctgtggtcactggagctgtg
gtcgctgctgtgatgtggaggaggaagagctcagatagaaaaggagggagctactctcag
gctgcaagcagtgacagtgcccagggctctgatgtgtctctcacggcttgtaaagtgtgg
gacagctaa

KEGG   Macaca fascicularis (crab-eating macaque): 102132408
Entry
102132408         CDS       T02918                                 

Gene name
Mafa, Mafa-B, Mafa-B7
Definition
(RefSeq) HLA class I histocompatibility antigen, B-14 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102132408 (Mafa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102132408 (Mafa)
   04145 Phagosome
    102132408 (Mafa)
  09143 Cell growth and death
   04218 Cellular senescence
    102132408 (Mafa)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102132408 (Mafa)
   04612 Antigen processing and presentation
    102132408 (Mafa)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102132408 (Mafa)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102132408 (Mafa)
   05170 Human immunodeficiency virus 1 infection
    102132408 (Mafa)
   05168 Herpes simplex virus 1 infection
    102132408 (Mafa)
   05163 Human cytomegalovirus infection
    102132408 (Mafa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102132408 (Mafa)
   05169 Epstein-Barr virus infection
    102132408 (Mafa)
   05165 Human papillomavirus infection
    102132408 (Mafa)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102132408 (Mafa)
   05330 Allograft rejection
    102132408 (Mafa)
   05332 Graft-versus-host disease
    102132408 (Mafa)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102132408 (Mafa)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102132408 (Mafa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102132408 (Mafa)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102132408 (Mafa)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102132408 (Mafa)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102132408 (Mafa)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_C C2-set_2 ig
Other DBs
NCBI-GeneID: 102132408
NCBI-ProteinID: XP_015300231
Position
Un
AA seq 418 aa
MASAGRSEGIAGGGAGPGEPRGEEGRAGLSLSSPPGSHSLRYFSAGTSRPGRGEPRFISV
GYVDDTQFLRFDSDAASPRMEPRAPWAEQEGPEYWEEQTGLAKDITQSFRVGLGNLRGYY
NQSEAGSHTLQWMYGCDLGPDGRLLRGYHQFAYDGKDYIALNGDLRSWTAADTAAQITQR
KWEAAREAEQWRAHLEGTCVEWLRRHLENGKEMLQRADPPKTHMTHHPISDHEATLRCWA
LGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTYQKWGAVVVPSGEEQRYTCHVQHEG
LPEPLTLRWEPSSQSTIPIVGIVVGLAVLAVVVTGAVVAAVMWRRKSSVPSQDIFLLQVE
KEGATLRLCVSGGGGSVEELTHPVIPPVPRLLWALTRSCFCSTPASDSAQGSDVCLTA
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcctctgcggggaggagcgaggggatcgcaggcgggggcgcaggacccggggagccg
cgcggggaggagggtcgggcgggtctcagcctctcctcgcccccaggctcgcactccttg
aggtatttcagcgccggcacgtcccggcccggccgcggggagccccgcttcatctccgtg
ggctacgtggacgacacgcagttcctgcggttcgacagcgacgccgcgagtccgaggatg
gagccgcgggcgccgtgggcggagcaggaggggccggagtattgggaagagcagacaggg
ctcgccaaggacatcacacagtccttccgagtgggcctggggaacctgcgcggctactac
aaccagagcgaggcggggtctcacaccctccagtggatgtacggctgtgacctggggccc
gacgggcgcctcctccgcgggtatcaccagttcgcctacgacggcaaggattacatcgcc
ctgaacggggacctgcgctcctggaccgcggcagacacggcggctcagataacccagcgc
aagtgggaggcggcccgcgaggcagagcagtggagagcccacctggaggggacgtgcgtg
gagtggctccgcagacacctggagaacgggaaggagatgctgcagcgcgcggatccccca
aagacacacatgacccaccaccccatctctgaccatgaggccaccctgaggtgctgggcc
ctgggcttctaccctgcggagatcacactgacctggcagcgggatggggaggagcaaact
caggacaccgagcttgtggagaccaggccagcaggagatggaacctaccagaagtgggga
gctgtggtggtgccttctggagaagagcagagatacacgtgccatgtgcagcatgagggg
ctgccggaacccctcaccctgagatgggagccatcttcccagtccaccatccccatcgtg
ggcatcgttgttggcctggctgtcctagcagttgtggtcactggagctgtggtggctgct
gtgatgtggaggaggaagagctcagtcccctcacaggacattttcttgctacaggtggaa
aaggagggagctactctcaggctgtgtgtaagtggtgggggtgggagtgtggaggagctc
acccatcccgtaattcctcctgtcccacgtctcctgtgggctctgacgaggtcctgtttt
tgttctaccccagccagtgacagtgcccagggctctgatgtgtgtctcacggcttga

KEGG   Macaca fascicularis (crab-eating macaque): 102132794
Entry
102132794         CDS       T02918                                 

Gene name
Mafa-A, Mafa-AG
Definition
(RefSeq) HLA class I histocompatibility antigen, A-11 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102132794 (Mafa-A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102132794 (Mafa-A)
   04145 Phagosome
    102132794 (Mafa-A)
  09143 Cell growth and death
   04218 Cellular senescence
    102132794 (Mafa-A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102132794 (Mafa-A)
   04612 Antigen processing and presentation
    102132794 (Mafa-A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102132794 (Mafa-A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102132794 (Mafa-A)
   05170 Human immunodeficiency virus 1 infection
    102132794 (Mafa-A)
   05168 Herpes simplex virus 1 infection
    102132794 (Mafa-A)
   05163 Human cytomegalovirus infection
    102132794 (Mafa-A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102132794 (Mafa-A)
   05169 Epstein-Barr virus infection
    102132794 (Mafa-A)
   05165 Human papillomavirus infection
    102132794 (Mafa-A)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102132794 (Mafa-A)
   05330 Allograft rejection
    102132794 (Mafa-A)
   05332 Graft-versus-host disease
    102132794 (Mafa-A)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102132794 (Mafa-A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102132794 (Mafa-A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102132794 (Mafa-A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102132794 (Mafa-A)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102132794 (Mafa-A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102132794 (Mafa-A)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 102132794
NCBI-ProteinID: NP_001306417
UniProt: E0WKX9
Position
Un
AA seq 336 aa
MAVMAPRTLLLVLSGVLALTQPRAGSHSMRYFYTAVSRPGRGQPRFIAVGYVDDTQFVRF
DSDAESPRMEPRAPWVEQEGPEYWDRETQNMKTATQTYQANLRTLLRYYNQSEAGSHTFQ
KMYGCDLGPDGRLLRGYEQFAYDGRDYIILNEDLRSWTAADMAAQNTQRKWEAAGAAEQH
RTYLEGECLEWLRRYLENGKETLQRADPPKTNVTHHPVSDYEATLRCWALGFYPAEITLT
WQRDGEEQTEDTELVETRPTGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQSTILIVGIIAGLVLLGTVVTGAVVAAVMWRRKS
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggcggtcatggcgccccgaaccctcctcctggtgctctcaggggtcctggccctgacc
cagccccgggcgggctcgcactccatgaggtatttctacaccgccgtgtcccggcccggc
cgcgggcagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgagagtccgaggatggagccgcgggcgccgtgggtggagcaggagggt
ccagagtattgggaccgggagacacagaacatgaagaccgcgacacagacctaccaagcg
aacctgcggaccctgctccgctactacaaccagagcgaggccgggtctcacaccttccag
aagatgtacggctgcgacctggggccagacgggcgcctcctccgcgggtatgaacagttc
gcctacgacggcagggattacatcatcctgaacgaggacctgcgctcctggaccgccgcg
gacatggcggctcagaacacccagcgcaagtgggaggcggcgggtgcggcggagcagcac
agaacctacctggagggcgagtgcctggagtggctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcggacccccccaagacaaatgtgacccaccaccctgtctctgac
tacgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggagaggaacaaactgaggacacagagctcgtggagaccaggcctaca
ggggatggaaccttccagaagtgggcggctgtggtggtgccttctggagaggagcagaga
tacacctgtcatgtgcaacatgagggtctgcccaagcccctcaccttgagatgggagcca
tcttcccagtctaccatcctcatcgtaggcatcattgctggcctggttctccttggaact
gtggtcactggagctgtggttgctgctgtgatgtggaggaggaagagctaa

KEGG   Macaca fascicularis (crab-eating macaque): 102138874
Entry
102138874         CDS       T02918                                 

Gene name
MHC-E, Mafa-E, Mafa-E-01, Mafa-E-02, Mafa-IE, mafa-E1
Definition
(RefSeq) popy class I histocompatibility antigen, alpha chain E
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102138874 (MHC-E)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102138874 (MHC-E)
   04145 Phagosome
    102138874 (MHC-E)
  09143 Cell growth and death
   04218 Cellular senescence
    102138874 (MHC-E)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102138874 (MHC-E)
   04612 Antigen processing and presentation
    102138874 (MHC-E)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102138874 (MHC-E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102138874 (MHC-E)
   05170 Human immunodeficiency virus 1 infection
    102138874 (MHC-E)
   05168 Herpes simplex virus 1 infection
    102138874 (MHC-E)
   05163 Human cytomegalovirus infection
    102138874 (MHC-E)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102138874 (MHC-E)
   05169 Epstein-Barr virus infection
    102138874 (MHC-E)
   05165 Human papillomavirus infection
    102138874 (MHC-E)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102138874 (MHC-E)
   05330 Allograft rejection
    102138874 (MHC-E)
   05332 Graft-versus-host disease
    102138874 (MHC-E)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102138874 (MHC-E)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102138874 (MHC-E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102138874 (MHC-E)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102138874 (MHC-E)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102138874 (MHC-E)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102138874 (MHC-E)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 MHC_I_3 ig C2-set_2 DUF6215 SNO
Other DBs
NCBI-GeneID: 102138874
NCBI-ProteinID: XP_005553705
UniProt: A0A2K5TNE4
Position
4
AA seq 359 aa
MALRTLLLLLSALTKTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRYDSDAAS
PRMEPRAPWVEQEGPEYWDQETRSARDTAQTFRVNLETLRGYYNQSEAGSHTLQWMHGCD
LGSDGRFLRGYEQFAYDGKDYLTLNEDLRSWSAMDTAAQISEQKSNDGGEAEHQRAYLED
TCVEWLRRYLENGKETLQRSESPKTHVTHHPVSDHEATLRCWALGFYPAEITVTWQRDGE
DQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQSTI
PIVGIIAGLVLLGAVVTGAVVAAVMWRRKSSGRKGGSYSQASCSDSTQGSDESLTAYKT
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcactacgaaccctacttctcctgctctcggcccttaccaagacctgggcgggctcc
cactccttgaagtatttccacacttccgtgtcccggcccggccgcggggagccccgcttc
atctccgtgggctacgtggacgacacccagttcgtgcggtacgacagcgatgccgcgagt
ccgaggatggagccgcgggcgccgtgggtggagcaggaggggccggagtattgggaccag
gagacacggagcgccagggacaccgcacagactttccgagtgaacctggagaccctgcgc
ggctactacaaccagagcgaggccgggtctcataccctccagtggatgcatggctgcgac
ctggggtccgacgggcgcttcctccgcgggtatgaacagttcgcctacgacggcaaggat
tatctcaccctgaatgaggacctgcgctcctggtccgcgatggacacggcggctcagatc
tctgagcaaaagtcaaatgatggcggtgaggcggagcaccagagagcctacctggaagac
acatgcgtggagtggctccgcagatacctggagaatgggaaggagacgctgcagcgctcg
gaatccccaaagacacacgtgacccaccaccccgtctctgatcatgaggccaccctgagg
tgctgggccctgggcttctaccctgcggagatcacagtgacctggcagcgggatggggag
gaccagacccaggacacggagcttgtggagaccaggcctgcaggggatggaactttccag
aagtgggcagctgtggtggtgccttctggagaggagcagagatacacgtgccatgtgcag
catgaggggctacccgagcccctcaccctgagatgggagccgtcttcccagtccaccatc
cccatcgtgggcatcattgctggcctggttctccttggagctgtggtcactggagctgtg
gttgctgctgtgatgtggaggaggaagagctcaggtagaaaaggagggagctactctcag
gcttcgtgtagcgacagtacccagggatctgatgagtctctcacagcttataaaacctga

KEGG   Macaca fascicularis (crab-eating macaque): 102138883
Entry
102138883         CDS       T02918                                 

Gene name
Mafa-B
Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102138883 (Mafa-B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102138883 (Mafa-B)
   04145 Phagosome
    102138883 (Mafa-B)
  09143 Cell growth and death
   04218 Cellular senescence
    102138883 (Mafa-B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102138883 (Mafa-B)
   04612 Antigen processing and presentation
    102138883 (Mafa-B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102138883 (Mafa-B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102138883 (Mafa-B)
   05170 Human immunodeficiency virus 1 infection
    102138883 (Mafa-B)
   05168 Herpes simplex virus 1 infection
    102138883 (Mafa-B)
   05163 Human cytomegalovirus infection
    102138883 (Mafa-B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102138883 (Mafa-B)
   05169 Epstein-Barr virus infection
    102138883 (Mafa-B)
   05165 Human papillomavirus infection
    102138883 (Mafa-B)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102138883 (Mafa-B)
   05330 Allograft rejection
    102138883 (Mafa-B)
   05332 Graft-versus-host disease
    102138883 (Mafa-B)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102138883 (Mafa-B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102138883 (Mafa-B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102138883 (Mafa-B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102138883 (Mafa-B)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102138883 (Mafa-B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102138883 (Mafa-B)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 MHC_I_3 C2-set_2 ig HCV_NS4a
Other DBs
NCBI-GeneID: 102138883
NCBI-ProteinID: NP_001270024
UniProt: E5FNB1
Position
4
AA seq 362 aa
MRVMAPRTLLLLLSAALALTETRAGSHSMRYFTTAVSRPGRGEPRFIAVGYVDDTQFVGF
DSDAESPRMEPRAPWMEQEGPEYWEEETRKVKETAQTFRVSLGNLRGYYNQSEAGSHTYQ
WMYGCDLGPDGRLLRGYHQYAYDGKDYIALNRDLRSWTAADEAAQNTQRKWEAAGVAEQM
RVYLEGQCLECLRGYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEEQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQSTIPIVGIVAGLAVLAVVVTGAVVVAVMWRRKSSGGKGGSYSQAASSDSAQGSDVSL
TA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcgagtcatggcgccccgaaccctcctcctgctgctctcggcggccctggccctgacc
gagacccgggccggctcgcactccatgaggtatttcaccaccgccgtgtcccggcccggc
cgcggggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtggggttc
gacagcgacgccgagagtccgaggatggagccgcgggcgccgtggatggagcaggagggc
ccggagtattgggaagaggagacacggaaagtcaaggagaccgcacagactttccgagtc
agcctggggaacctgcgcggctactacaaccagagcgaggccgggtctcacacctaccag
tggatgtacggctgcgacctggggcccgacgggcgcctcctccgcgggtatcaccagtac
gcctacgacggcaaggattacatcgccctgaacagggacctgcgctcctggaccgctgcg
gatgaggcggctcagaacacccagcgcaagtgggaggcggcgggtgtggcggagcagatg
agagtctacctggaggggcagtgcctggaatgtctccgcggatacctggagaacgggaag
gagacgctgcagcgcgcggatcccccaaagacacacgtgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggagcaaactcaggacaccgagctcgtggagaccaggccagga
ggagatggaaccttccagaagtggggagctgtggtggtgccttctggagaagagcagaga
tacacgtgccatgtgcagcacgaggggctcccggagcccctcaccctgagatgggagcca
tcttcccagtccaccatccccatcgtgggcattgttgctggcctggctgtcctagcagtt
gtggtcactggagctgtggtcgttgctgtgatgtggaggaggaagagctcaggtggaaaa
ggagggagctactctcaggctgcgtccagcgacagtgcccagggctctgatgtgtctctc
acggcttga

KEGG   Macaca fascicularis (crab-eating macaque): 102138996
Entry
102138996         CDS       T02918                                 

Gene name
Mafa-B, Mafa-B14
Definition
(RefSeq) HLA class I histocompatibility antigen, B-49 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102138996 (Mafa-B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102138996 (Mafa-B)
   04145 Phagosome
    102138996 (Mafa-B)
  09143 Cell growth and death
   04218 Cellular senescence
    102138996 (Mafa-B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102138996 (Mafa-B)
   04612 Antigen processing and presentation
    102138996 (Mafa-B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102138996 (Mafa-B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102138996 (Mafa-B)
   05170 Human immunodeficiency virus 1 infection
    102138996 (Mafa-B)
   05168 Herpes simplex virus 1 infection
    102138996 (Mafa-B)
   05163 Human cytomegalovirus infection
    102138996 (Mafa-B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102138996 (Mafa-B)
   05169 Epstein-Barr virus infection
    102138996 (Mafa-B)
   05165 Human papillomavirus infection
    102138996 (Mafa-B)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102138996 (Mafa-B)
   05330 Allograft rejection
    102138996 (Mafa-B)
   05332 Graft-versus-host disease
    102138996 (Mafa-B)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102138996 (Mafa-B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102138996 (Mafa-B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102138996 (Mafa-B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102138996 (Mafa-B)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102138996 (Mafa-B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102138996 (Mafa-B)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig MHC_I_2
Other DBs
NCBI-GeneID: 102138996
NCBI-ProteinID: XP_015305123
Position
4
AA seq 330 aa
MRYFHTAVSRPGRGEPRFIYVGYVDDTQFVRFDSDATSPRMEPRAPWIEQEGPEYWDRET
HKAKAHAQVFRVNLRTALRYYNQSEAGSHTFQRMHGCDLGPDGRLLRGYHQLAYDGKDYI
ALNGDLSSWSAADMAAQVTQRKWEAAGEAEQRRAYLEGECLESLRRYLENGKETLQRVDP
PKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDRTFQKW
AAVVVPSGEEQRYMCHVQHQGLLEPLTLRWERASQPSIPIVGIVAGLAVLGTVVTVAVVA
AVMRRTESSGSSSAQGSDQDSDESLMACKA
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaggtatttccacaccgccgtgtcccggcccggccgcggggagccccgcttcatctac
gtgggctacgtggacgacacgcagttcgtgcggttcgacagcgacgccacgagtccgagg
atggagccgcgggcgccgtggatagagcaggaggggccggagtattgggaccgggagaca
cacaaagccaaggcccacgcacaggttttccgagtgaacctgcgcaccgcgcttcgctac
tacaaccagagcgaggccgggtctcacaccttccagaggatgcacggctgcgacctgggg
ccagacgggcgcctcctccgcgggtatcaccagttagcctatgatggcaaggattacatc
gccctgaacggggacctgagctcctggagcgccgcggatatggcggctcaggtcacacag
cgcaagtgggaggcggccggtgaagctgagcagcggagagcctacctggagggcgagtgc
ctggagtcgctccgcagatacctggagaacgggaaggagacgctgcagcgcgtggatccc
ccaaagacacacgtgacccaccaccccgtctctgaccatgaggccacactgaggtgctgg
gctctgggcttctaccctgcggagatcacactgacctggcagcgagatggggaggagcaa
actcaggacactgagcttgtggagaccaggccagcaggggacagaaccttccagaaatgg
gcagctgtggtggtaccttctggagaagagcagagatacatgtgccatgtgcagcaccag
gggctgctggagcccctcaccctgagatgggaacgggcttcccagccctccatccccatc
gtgggcatcgttgctggcctggctgtcttaggaactgtggtcaccgtagctgtggttgct
gctgtgatgcggaggacagagagctcagggagcagcagtgcccagggctctgatcaggac
tctgatgagtctctcatggcctgtaaagcctga

KEGG   Macaca fascicularis (crab-eating macaque): 102141835
Entry
102141835         CDS       T02918                                 

Gene name
Mafa-B
Definition
(RefSeq) HLA class I histocompatibility antigen, B-7 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102141835 (Mafa-B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102141835 (Mafa-B)
   04145 Phagosome
    102141835 (Mafa-B)
  09143 Cell growth and death
   04218 Cellular senescence
    102141835 (Mafa-B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102141835 (Mafa-B)
   04612 Antigen processing and presentation
    102141835 (Mafa-B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102141835 (Mafa-B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102141835 (Mafa-B)
   05170 Human immunodeficiency virus 1 infection
    102141835 (Mafa-B)
   05168 Herpes simplex virus 1 infection
    102141835 (Mafa-B)
   05163 Human cytomegalovirus infection
    102141835 (Mafa-B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102141835 (Mafa-B)
   05169 Epstein-Barr virus infection
    102141835 (Mafa-B)
   05165 Human papillomavirus infection
    102141835 (Mafa-B)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102141835 (Mafa-B)
   05330 Allograft rejection
    102141835 (Mafa-B)
   05332 Graft-versus-host disease
    102141835 (Mafa-B)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102141835 (Mafa-B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102141835 (Mafa-B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102141835 (Mafa-B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102141835 (Mafa-B)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102141835 (Mafa-B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102141835 (Mafa-B)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig Ig_2 MHC_I_C T_cell_tran_alt Psg1
Other DBs
NCBI-GeneID: 102141835
NCBI-ProteinID: XP_015305119
Position
4
AA seq 406 aa
MSREANQRRRGLSSKVPTRPSGLRVSSDTKMRVMAPRTLLLLLSGALALTETWAGSHSLR
YFHTAVSRPGRWEPRFISVGYVDDTQFVRFDSDAASPRTEPRAPWVEQEGPEYWEEETRR
AKAHAQTDRVDLGTLRGYYNQSEAGSHTIQTMYGCDLGPDGRLLRGYDQYAYDGKDYIAL
NEDLRSWTAADMAAQNTQRKWEAARYAERFRAYLEGECVEWLRRYLENGKETLQRADPPK
THVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAA
VVVSSGEEQRYTCHVQHKGLLEPLTLRWEPSSQSTIPIVGIVVGLAVLAVVVTGAVVAAV
MWRRKSSGGKEGSYSQAACKWWGWECGGDHPSRNSSCPTSPAGSGL
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtctagagaagccaatcagcgtcgccgcggtctcagttctaaagtccccacgcgccca
tccgggctcagagtctcctcagacaccaagatgcgggtcatggcgccccgaaccctcctc
ctgctgctctcgggggccctggccctgaccgagacctgggccggctcgcactccttgagg
tatttccacaccgccgtgtcccggcccggccgctgggagccccgcttcatctccgtgggc
tacgtggacgacacgcagttcgtgcggttcgacagcgacgccgcgagtccgaggacggag
ccgcgggcgccgtgggtggagcaggaggggccggagtattgggaagaggagacacggaga
gccaaggcccacgcacagactgaccgagtggacctggggaccctgcgcggctactacaac
cagagcgaggcggggtctcacaccatccagacgatgtacggctgcgacctgggacccgac
gggcgcctcctccgcgggtatgaccagtacgcctacgacggcaaggattacatcgccctg
aacgaggacctgcgctcctggacggccgcggacatggcggctcagaacacccagcgcaag
tgggaggcggcccgttatgcggagcggttcagagcctacctggagggcgagtgcgtggag
tggctccgcagatacctggagaacgggaaggagacgctgcagcgcgcggatcccccaaag
acacacgtgacccaccaccccatatctgaccatgaggccaccctgaggtgctgggccctg
ggcttctaccctgcggagatcacactgacctggcagcgggatggggaggaccaaactcag
gacaccgagcttgtggagaccaggcccgcaggggatggaaccttccagaagtgggcagct
gtggtggtgtcttctggagaagagcagagatacacgtgccatgtgcagcacaaggggctg
ctggagcccctcaccctgagatgggagccatcttcccagtccaccatccccatcgtgggc
attgttgttggcctggctgtcctagcagttgtggtcaccggagctgtggtcgcagctgtg
atgtggaggaggaagagctcaggtggaaaagaagggagctactctcaggctgcgtgtaag
tggtgggggtgggagtgtggaggagatcacccatcccgtaattcctcctgtcccacgtct
cctgcgggctctgggctctga

KEGG   Macaca fascicularis (crab-eating macaque): 102142617
Entry
102142617         CDS       T02918                                 

Gene name
Mafa-B
Definition
(RefSeq) HLA class I histocompatibility antigen, B-14 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102142617 (Mafa-B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102142617 (Mafa-B)
   04145 Phagosome
    102142617 (Mafa-B)
  09143 Cell growth and death
   04218 Cellular senescence
    102142617 (Mafa-B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102142617 (Mafa-B)
   04612 Antigen processing and presentation
    102142617 (Mafa-B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102142617 (Mafa-B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102142617 (Mafa-B)
   05170 Human immunodeficiency virus 1 infection
    102142617 (Mafa-B)
   05168 Herpes simplex virus 1 infection
    102142617 (Mafa-B)
   05163 Human cytomegalovirus infection
    102142617 (Mafa-B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102142617 (Mafa-B)
   05169 Epstein-Barr virus infection
    102142617 (Mafa-B)
   05165 Human papillomavirus infection
    102142617 (Mafa-B)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102142617 (Mafa-B)
   05330 Allograft rejection
    102142617 (Mafa-B)
   05332 Graft-versus-host disease
    102142617 (Mafa-B)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102142617 (Mafa-B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102142617 (Mafa-B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102142617 (Mafa-B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102142617 (Mafa-B)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102142617 (Mafa-B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102142617 (Mafa-B)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 102142617
NCBI-ProteinID: NP_001306431
UniProt: A0A0S4XLM7
Position
4
AA seq 364 aa
MRVMAPGTLLLLLSGALALALTETWAGSHSLRYFSVGTSRPGRGEPHFISVGYVDDTQFV
RFDSDVASPRVEPRAPWAEQEGPEYWEEQTRIAKDLAQTFGVDLRTALLYYNQSEAGSHT
FQWMFGCDLGPDGRLLRGYHQFAHDGKDYITLNEDLRSWTAADTAAQNTQRKWEAAREAE
QWRAHVEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEIT
LTWQRDGEDQTQDTELVETRPAGDGTYQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRW
EPSSQSTIPIVGIVAGLAVLAVVVTGAVIAAVMWRRKNSGGKGGSYSQAASSDSAQGSDE
SLTA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgcccggaaccctcctcctgctgctctcgggggccctggccctggcc
ctgaccgagacctgggccggctcgcactccttgaggtatttcagcgtcggcacgtcccgg
cccggccgcggggagccccacttcatctccgtgggctacgtggacgacacgcagttcgtg
cggttcgacagcgacgtcgcgagtccgagggtggagccgcgggcgccgtgggcggagcag
gaggggccggagtattgggaagagcagacacggatcgccaaggacctcgcacagactttc
ggagtggacctgcggaccgcgctcctctactacaaccagagcgaggcggggtctcacacc
ttccagtggatgttcggctgcgacctgggacccgacgggcgcctcctccgcgggtatcac
cagttcgcccacgacggcaaggattacatcaccctgaacgaggacctgcgctcctggacc
gcggcagacacggcggctcagaacacccagcgcaagtgggaggcggcccgcgaggcagag
cagtggagagcccacgtggaggggacgtgcgtggagtggctccgcagatacctggagaac
gggaaggagacgctgcagcgcgcggatcccccaaagacacatgtgacccaccaccccgtc
tctgaccatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcaca
ctgacctggcagcgggatggggaggaccaaactcaggacactgagcttgtggagaccagg
ccagcaggagatggaacctaccagaagtggggagctgtggtggtgccttctggagaagag
cagagatacacgtgccatgtgcagcatgaggggctgccggagcccctcaccctgagatgg
gagccatcttcccagtccaccatccccatcgtgggcattgttgctggcctggctgtccta
gcagttgtggtcaccggagctgtgatcgctgctgtgatgtggaggaggaagaactcaggt
ggaaaaggagggagctactctcaggctgcgtccagcgacagtgcccagggatctgatgag
tctctcacggcttga

KEGG   Macaca fascicularis (crab-eating macaque): 102145933
Entry
102145933         CDS       T02918                                 

Gene name
Mafa-I
Definition
(RefSeq) class I histocompatibility antigen, Gogo-B*0101 alpha chain
  KO
K06751  MHC class I antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04144  Endocytosis
mcf04145  Phagosome
mcf04218  Cellular senescence
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04940  Type I diabetes mellitus
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
mcf05320  Autoimmune thyroid disease
mcf05330  Allograft rejection
mcf05332  Graft-versus-host disease
mcf05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102145933 (Mafa-I)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102145933 (Mafa-I)
   04145 Phagosome
    102145933 (Mafa-I)
  09143 Cell growth and death
   04218 Cellular senescence
    102145933 (Mafa-I)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102145933 (Mafa-I)
   04612 Antigen processing and presentation
    102145933 (Mafa-I)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102145933 (Mafa-I)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102145933 (Mafa-I)
   05170 Human immunodeficiency virus 1 infection
    102145933 (Mafa-I)
   05168 Herpes simplex virus 1 infection
    102145933 (Mafa-I)
   05163 Human cytomegalovirus infection
    102145933 (Mafa-I)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102145933 (Mafa-I)
   05169 Epstein-Barr virus infection
    102145933 (Mafa-I)
   05165 Human papillomavirus infection
    102145933 (Mafa-I)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102145933 (Mafa-I)
   05330 Allograft rejection
    102145933 (Mafa-I)
   05332 Graft-versus-host disease
    102145933 (Mafa-I)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102145933 (Mafa-I)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102145933 (Mafa-I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102145933 (Mafa-I)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
    102145933 (Mafa-I)
Exosome [BR:mcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   102145933 (Mafa-I)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Antigens
  102145933 (Mafa-I)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 102145933
NCBI-ProteinID: NP_001306439
UniProt: Q003H1
Position
Un
AA seq 362 aa
MRVMAPRTLLLLLSGALALTETWAGSHSLRYFGTTVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAESPRMEPRAPWMEQEGPEYWEEETRIAKARAQTERGNLRTALRYYNQSEGGSHTLQ
KMCGCDLGPDGRLLRGYYQSAYDGRDYIALNEDLRSWTAAGEAAQNTQRKWEAAGEAEQR
RAYLEGRCVEWLRRYLEKGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEEQTQDTELVETRPGGDGNFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQSTIPIMGIVAGLAVLAVVVTGAVVAAVMWRRKSSGGKGGSYSQAASSNSAQGSDVSL
TA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgaaccctcctcctgctgctctcgggggccctggccctgacc
gagacctgggccggctcgcactccttgaggtatttcggcaccacagtgtcccggcccggc
cgcggggagccgcgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgagagtccgaggatggagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggaagaggagacacggatcgccaaggcccgcgcacagactgagcgaggg
aacctgcggaccgcgctccgctactacaaccagagcgagggggggtctcacaccctccag
aagatgtgtggctgcgacctggggccggacgggcgcctcctccgcgggtattaccagtcc
gcctacgacggcagggattacatcgccctgaacgaggacctgcgctcctggaccgctgcg
ggtgaggcggctcagaacacccagcgcaagtgggaggcggccggtgaggcagagcagcgg
agagcctacctggagggccggtgcgtggagtggctccgcagatacctggagaaggggaag
gagacgctgcagcgcgcggatcccccaaagacacacgtgacccaccaccccgtctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggagcaaactcaggacaccgagcttgtggagaccaggccagga
ggagatggaaacttccagaagtgggcagctgtggtggtgccttctggagaagagcagaga
tacacgtgccatgtgcagcatgaggggctgccggagcccctcaccctgagatgggagcca
tcttcccagtccaccatccccatcatgggcattgttgctggcctggctgtcctagcagtt
gtggtcaccggagctgtggtcgcagctgtgatgtggaggaggaagagctcaggtggaaaa
ggagggagctactctcaggctgcgtccagcaacagtgcccagggctctgatgtgtctctc
acagcttga

DBGET integrated database retrieval system