KEGG   Macaca fascicularis (crab-eating macaque): 102115323
Entry
102115323         CDS       T02918                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin 5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102115323 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102115323 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102115323 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102115323 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102115323 (IL5RA)
   04090 CD molecules [BR:mcf04090]
    102115323 (IL5RA)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL3 receptor family
   102115323 (IL5RA)
CD molecules [BR:mcf04090]
 Proteins
  102115323 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac
Other DBs
NCBI-GeneID: 102115323
NCBI-ProteinID: NP_001274656
UniProt: C3VEW9
Position
2
AA seq 420 aa
MIIMAPVLLILLGATEILQADLLPDDKISLLPPVNFTIKVTGLAQVLLRWEPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQKDHSLLASSWASAELHA
PPGSPGTSVVNLTCTTNTTADNYSYLRPYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDSMGRNIACWFPRTFIHSRGRDWLAVLVNGSSKHSAIKPFDQLFALHAIDQIN
PPLNVTAEIKGTRLSIQWEKPVSAFPIHCFDYEVKIHNARNGYLQIEKMMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGKDEHKPLRQWFLIVLMATICFILLILLL
ICRICHLWIKLFPPIPAPKSNIKDLFVTANYEKAGSVETEIEVISYIEKPGVETLEDSVF
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgatcatcatggcacctgtattactgatacttttgggggccactgagatactgcaagct
gacttacttcctgatgacaagatttcacttctcccacctgtcaatttcaccattaaagtt
actggtttggctcaagttcttttacgttgggaaccaaatcctgatcaagagcaaaggaat
gttaatctagaatatcaagtgaaaataaacgctccaaaagaagatgattatgaaaccaga
atcactgaaagcaaatgcgtaaccatcctccacaaaggattttcagcaagtgtgcggacc
atcctgcagaaggaccactcactcctggccagcagctgggcttctgctgaacttcatgcc
ccaccagggtctcccggaacctcagttgtgaatttaacttgcaccacaaacactacagca
gataattattcatatttaaggccataccaagtttcccttcactgcacctggcttgttggc
acagatgcccctgaggacacgcagtattttctctactataggtatggctcttggactgaa
gaatgccaagaatacagcaaagactcaatggggagaaatatcgcatgctggtttcccagg
acttttatccacagcagagggcgtgactggcttgcagtgcttgttaacggctccagcaag
cactctgccatcaagccctttgatcagctgtttgcccttcatgccattgatcaaataaat
ccgccactgaatgtcacagcagagattaaaggaactcgtctctctatccaatgggagaaa
ccagtgtctgcctttccaatccattgctttgattatgaagtaaaaatacacaatgcaagg
aacggatatttgcagatagaaaaaatgatgaccaatgcattcatctcaataattgatgat
ctttctaagtatgatgttcaagtgagagcagcagtgagctccatgtgcagagaggcgggg
ctctggagtgagtggagccaacctatttatgtgggaaaagatgaacacaagcccttgaga
cagtggtttctcattgtgcttatggcaaccatctgcttcatcttgttaattctcttgctt
atctgtagaatatgtcatttatggatcaagttgtttccaccaattccagcaccaaaaagt
aatatcaaagatctctttgtaactgctaactatgagaaagctggttccgttgagacagaa
attgaagtcatcagttatatagagaagcctggagttgagaccctggaggattctgtgttt
tga

DBGET integrated database retrieval system