KEGG   Macaca fascicularis (crab-eating macaque): 102115663
Entry
102115663         CDS       T02918                                 

Gene name
ANPEP
Definition
(RefSeq) alanyl aminopeptidase, membrane
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00480  Glutathione metabolism
mcf01100  Metabolic pathways
mcf04614  Renin-angiotensin system
mcf04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102115663 (ANPEP)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102115663 (ANPEP)
  09152 Endocrine system
   04614 Renin-angiotensin system
    102115663 (ANPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcf01002]
    102115663 (ANPEP)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcf04131]
    102115663 (ANPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102115663 (ANPEP)
   04090 CD molecules [BR:mcf04090]
    102115663 (ANPEP)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     102115663 (ANPEP)
Peptidases and inhibitors [BR:mcf01002]
 Metallo peptidases
  Family M1
   102115663 (ANPEP)
Membrane trafficking [BR:mcf04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    102115663 (ANPEP)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102115663 (ANPEP)
CD molecules [BR:mcf04090]
 Proteins
  102115663 (ANPEP)
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1 Peptidase_M1_N Aminopep DUF5700 HRG BSP
Other DBs
NCBI-GeneID: 102115663
NCBI-ProteinID: XP_005560552
UniProt: A0A2K5UVR9
Position
7
AA seq 968 aa
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNAKSSLEASTTPSASATTSNP
TLATTLDQSILWNRYRLPNTLKPDSYQVTLRPYLTPDDRGLYIFKGSSTVRFTCKEATDV
IIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDRTELVEPTEYLVVHLRGSLVKDSQYEMD
SEFEGELADDLAGFYRSEYMEGDVKKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIH
PKDLTALSNMLPKGPSTPLPEDPNWSVTEFHTTPKMSTYLLAFIVSEFTYVETQASNDVL
IRIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGL
VTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEY
LGADYAEPTWNLKDLMVLNEVYRVMAVDALASSHPLSTPASEINTPAQISELFDSISYSK
GASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSVQLPTTVHNI
MDRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYLWIVPITSIRDGRQQED
YWLMNVRAQNNLFRTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQTDHLAIPVINRA
QIINDAFNLASARKVPVTLALTNTLFLIEETEYMPWEAALSSLSYFKLMFDRSEVYGPMK
NYLKKQVTPLFIHFRNNTNNWREIPENLMDQYNEINAISTACSNGVPECEEMVSSLFKQW
MENPNNNPIHPNLRSTVYCNAIAQGGEKEWDFAWEQFRNATLVNEADKLRAALACSNEVW
ILNRYLSYTLNPDLIRKQDATSTIISITNNVIGQSLVWDFVQSNWKKLFNDYGGGSFSFS
NLIQAVTRRFSTEYELQQLEQFKKDNEDTGFGSGTRALEQALEKTRANIKWVKENKEVVL
QWFTENSK
NT seq 2907 nt   +upstreamnt  +downstreamnt
atggccaagggcttctacatttccaagtccctgggcatcctggggatcctcctgggcgtg
gcggccgtgtgcacgatcatcgcactgtcagtggtgtactcccaggagaagaacaagaat
gccaagagctccctcgaggcctccaccaccccgtctgcctcagccaccaccagcaacccc
accttggccaccactttggaccaaagcatactgtggaaccgttaccgcctccccaacacg
ctgaaacccgattcctaccaggtgacgctgaggccgtacctcacccccgatgacaggggc
ctatacatttttaagggctccagtaccgtccgtttcacctgcaaggaggccaccgacgtc
atcatcatccacagcaaaaagctcaactacaccctcagccaggggcacagggtggtcctg
cgtggagtgggaggctcccagccccccgacatcgacagaaccgagctggtggagcccacc
gagtacctggtggtgcacctcaggggctccctggtgaaggacagccaatatgagatggac
agtgagttcgagggggagttggcagatgacctggcaggcttctaccgcagcgagtacatg
gagggcgatgtcaaaaaggtggtggccacaacgcagatgcaggccgcagacgcccggaag
tccttcccatgcttcgatgaaccagccatgaaggccgagttcaacatcacgcttatccac
cccaaggacctcacagccctgtccaacatgcttcccaaaggtcccagcaccccacttcca
gaagaccccaactggagtgtcaccgagttccacaccacgcccaagatgtccacgtacttg
ctggccttcattgtcagcgagttcacctacgtggagacgcaggcatccaatgatgtcttg
atccggatctgggcccggcccagtgccattgcggcgggtcacggcgattatgctctgaac
gtgacaggccccatccttaacttctttgccggtcattatgacacaccctacccacttcca
aaatcagaccagattggcctgcctgacttcaacgccggcgccatggagaactggggactg
gtgacctaccgggagaactccctgctgttcgaccccctgtcctcctccagcagcaacaag
gaacgggtggtcactgtgattgctcacgagctggcccaccagtggttcgggaacctggtg
accatagagtggtggaatgacctgtggttgaacgagggctttgcctcctacgtggagtac
ctgggtgctgactatgcagagcccacctggaacttgaaagacctcatggtgctgaacgaa
gtgtaccgcgtgatggccgtggatgcactggcctcctcccacccactgtccactcctgcc
tcggagatcaacacgccagcccagatcagtgagctgtttgactccatctcctacagcaag
ggcgcctcagtcctcaggatgctctccagcttcctgtccgaggatgtattcaagcagggc
ctggcatcctacctccacacctttgcctaccagaacaccatctacctgaacctgtgggac
cacctgcaggaggctgtgaacaaccggtccgtccaactccccaccaccgtgcacaacatc
atggatcgctggaccctgcagatgggcttcccggtcatcacggtggataccagcacgggg
actctttcccaggagcacttcctccttgaccccgattccaatgttacccgcccctcagaa
ttcaattacctgtggattgtgcctatcacatccatcagagatggcagacagcaggaggac
tactggctgatgaatgtaagagcccagaacaatctcttcagaacatcaggcaatgagtgg
gtcctgctgaacctcaatgtgacgggctattaccgggtgaactacgacgaagagaactgg
aggaagattcagactcagctgcagacagaccacttggccatccctgtcatcaatcgggca
cagatcattaatgatgccttcaacctggccagtgcccgtaaggtccctgtcactctggcg
ctgaccaacaccctcttcctgattgaagagacagagtacatgccctgggaggccgccctg
agcagcctgagctacttcaagctcatgttcgaccgctccgaggtctatggccccatgaag
aactacctgaagaagcaggtcacacccctcttcattcacttcagaaataacaccaacaac
tggagggagatcccagaaaacctgatggaccagtacaacgagattaacgccatcagcact
gcctgctccaatggagttccagaatgtgaggagatggtctctagccttttcaagcagtgg
atggagaaccccaataataacccgatccaccccaacctgcggtccaccgtctactgcaac
gctattgcccagggtggtgagaaggagtgggacttcgcctgggagcagttccgaaatgcc
acactggtcaatgaggccgacaagcttcgggcagccctggcctgcagcaacgaggtgtgg
atcctgaacaggtacctgagctacaccctgaaccccgacttaatccggaagcaggatgcc
acctctaccatcatcagcattaccaacaacgtcatcgggcaaagtttggtctgggacttt
gtccagagcaattggaagaagctctttaatgattatggtggtggctcgttctccttctcc
aacctcatccaggcagtgacacgacgattctccaccgagtatgagctgcagcagctggag
cagttcaagaaggacaacgaggacacaggcttcggctcaggcacccgggccctggagcaa
gccctggagaagacgagagccaacatcaagtgggtgaaggagaacaaggaggtggtgctc
cagtggttcacagaaaacagcaaatag

DBGET integrated database retrieval system